SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000007913 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000007913
Domain Number 1 Region: 40-223
Classification Level Classification E-value
Superfamily L domain-like 6.46e-40
Family Ngr ectodomain-like 0.0059
Further Details:      
 
Domain Number 2 Region: 231-343
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000096
Family I set domains 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000007913   Gene: ENSBTAG00000006024   Transcript: ENSBTAT00000007913
Sequence length 428
Comment pep:known chromosome:UMD3.1:21:34903758:34906887:-1 gene:ENSBTAG00000006024 transcript:ENSBTAT00000007913 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQELRLLCLVVLVGLAQACPEPCECGEKYGFHIADCAYRDLQAVPSGFPANVTTLSLSAN
QLPSLPGGAFREVPRLQSLWLAHNEIRSVAAGALASLSQLKSLDLSHNLISDFAWSDLHS
LSALQLLKMDSNELTFIPRDAFRSLRALRSLQLNHNRLHTLAEGTFAPLTALSHLQINDN
PFDCTCGIVWFKTWALTTAVSIPEQDNITCTSPHVLKGTRLNRLLPLPCSAPSVQLTYQP
SQDGAELRPGFVLALHCDVDGQPAPQLHWHIQTPGGTVEITSPNVGADGRALPGVLAASS
RPRFQAFANGSLLIPDFGKLEEGTYSCLATNELGSAESSVNVALATPGEGGEDALGRRFQ
GKAAEGKVCYTVDNEVQPSGPEDNVVIIYLSRARGPEAAATAEGVPGKQPPGLLLLGQSL
LFLFLASF
Download sequence
Identical sequences A4IFA6
ENSBTAP00000007913 ENSBTAP00000007913 9913.ENSBTAP00000007913 NP_001074198.1.59421 NP_001074198.1.76553 XP_005222002.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]