SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000007926 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000007926
Domain Number 1 Region: 2231-2384
Classification Level Classification E-value
Superfamily CalX-like 3.01e-30
Family CalX-beta domain 0.0036
Further Details:      
 
Domain Number 2 Region: 1726-1812,1840-1900
Classification Level Classification E-value
Superfamily CalX-like 1.7e-29
Family CalX-beta domain 0.00058
Further Details:      
 
Domain Number 3 Region: 2960-3088
Classification Level Classification E-value
Superfamily CalX-like 3.53e-29
Family CalX-beta domain 0.0017
Further Details:      
 
Domain Number 4 Region: 3926-4070
Classification Level Classification E-value
Superfamily CalX-like 3.4e-28
Family CalX-beta domain 0.0018
Further Details:      
 
Domain Number 5 Region: 2117-2247
Classification Level Classification E-value
Superfamily CalX-like 1.22e-27
Family CalX-beta domain 0.0016
Further Details:      
 
Domain Number 6 Region: 2598-2716
Classification Level Classification E-value
Superfamily CalX-like 7.19e-27
Family CalX-beta domain 0.0022
Further Details:      
 
Domain Number 7 Region: 1004-1133
Classification Level Classification E-value
Superfamily CalX-like 1.02e-26
Family CalX-beta domain 0.0028
Further Details:      
 
Domain Number 8 Region: 145-291
Classification Level Classification E-value
Superfamily CalX-like 1.83e-26
Family CalX-beta domain 0.0019
Further Details:      
 
Domain Number 9 Region: 4414-4536
Classification Level Classification E-value
Superfamily CalX-like 6.8e-26
Family CalX-beta domain 0.0022
Further Details:      
 
Domain Number 10 Region: 3585-3688
Classification Level Classification E-value
Superfamily CalX-like 4.05e-25
Family CalX-beta domain 0.002
Further Details:      
 
Domain Number 11 Region: 4265-4414
Classification Level Classification E-value
Superfamily CalX-like 6.93e-24
Family CalX-beta domain 0.0017
Further Details:      
 
Domain Number 12 Region: 1130-1281
Classification Level Classification E-value
Superfamily CalX-like 4.05e-23
Family CalX-beta domain 0.0043
Further Details:      
 
Domain Number 13 Region: 404-551
Classification Level Classification E-value
Superfamily CalX-like 9.29e-23
Family CalX-beta domain 0.0047
Further Details:      
 
Domain Number 14 Region: 1312-1484
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.07e-22
Family Laminin G-like module 0.083
Further Details:      
 
Domain Number 15 Region: 786-926
Classification Level Classification E-value
Superfamily CalX-like 3.4e-21
Family CalX-beta domain 0.0044
Further Details:      
 
Domain Number 16 Region: 5008-5142
Classification Level Classification E-value
Superfamily CalX-like 9.16e-21
Family CalX-beta domain 0.002
Further Details:      
 
Domain Number 17 Region: 4050-4188
Classification Level Classification E-value
Superfamily CalX-like 1.27e-20
Family CalX-beta domain 0.0035
Further Details:      
 
Domain Number 18 Region: 1988-2130
Classification Level Classification E-value
Superfamily CalX-like 1.31e-20
Family CalX-beta domain 0.0021
Further Details:      
 
Domain Number 19 Region: 886-1003
Classification Level Classification E-value
Superfamily CalX-like 5.1e-20
Family CalX-beta domain 0.0061
Further Details:      
 
Domain Number 20 Region: 4666-4804
Classification Level Classification E-value
Superfamily CalX-like 7.85e-20
Family CalX-beta domain 0.0065
Further Details:      
 
Domain Number 21 Region: 1880-1985
Classification Level Classification E-value
Superfamily CalX-like 3.14e-19
Family CalX-beta domain 0.0037
Further Details:      
 
Domain Number 22 Region: 1585-1713
Classification Level Classification E-value
Superfamily CalX-like 3.4e-19
Family CalX-beta domain 0.0028
Further Details:      
 
Domain Number 23 Region: 5225-5382
Classification Level Classification E-value
Superfamily CalX-like 9.02e-19
Family CalX-beta domain 0.0025
Further Details:      
 
Domain Number 24 Region: 2822-2957
Classification Level Classification E-value
Superfamily CalX-like 1.29e-18
Family CalX-beta domain 0.0026
Further Details:      
 
Domain Number 25 Region: 3668-3813
Classification Level Classification E-value
Superfamily CalX-like 1.57e-18
Family CalX-beta domain 0.0068
Further Details:      
 
Domain Number 26 Region: 2703-2837
Classification Level Classification E-value
Superfamily CalX-like 1.7e-18
Family CalX-beta domain 0.002
Further Details:      
 
Domain Number 27 Region: 1499-1606
Classification Level Classification E-value
Superfamily CalX-like 5.62e-18
Family CalX-beta domain 0.0065
Further Details:      
 
Domain Number 28 Region: 3097-3205
Classification Level Classification E-value
Superfamily CalX-like 1.57e-17
Family CalX-beta domain 0.0049
Further Details:      
 
Domain Number 29 Region: 2348-2393,2495-2573
Classification Level Classification E-value
Superfamily CalX-like 2.22e-17
Family CalX-beta domain 0.0029
Further Details:      
 
Domain Number 30 Region: 4170-4275
Classification Level Classification E-value
Superfamily CalX-like 1.31e-16
Family CalX-beta domain 0.0044
Further Details:      
 
Domain Number 31 Region: 38-156
Classification Level Classification E-value
Superfamily CalX-like 0.00000000000000183
Family CalX-beta domain 0.0017
Further Details:      
 
Domain Number 32 Region: 661-782
Classification Level Classification E-value
Superfamily CalX-like 0.0000000000000115
Family CalX-beta domain 0.0087
Further Details:      
 
Domain Number 33 Region: 295-399
Classification Level Classification E-value
Superfamily CalX-like 0.0000000000000301
Family CalX-beta domain 0.0069
Further Details:      
 
Domain Number 34 Region: 3775-3910
Classification Level Classification E-value
Superfamily CalX-like 0.000000000000209
Family CalX-beta domain 0.0032
Further Details:      
 
Domain Number 35 Region: 4539-4656
Classification Level Classification E-value
Superfamily CalX-like 0.000000000641
Family CalX-beta domain 0.0076
Further Details:      
 
Domain Number 36 Region: 4767-4874
Classification Level Classification E-value
Superfamily CalX-like 0.000000017
Family CalX-beta domain 0.014
Further Details:      
 
Domain Number 37 Region: 515-630
Classification Level Classification E-value
Superfamily CalX-like 0.0000000405
Family CalX-beta domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000007926   Gene: ENSBTAG00000006031   Transcript: ENSBTAT00000007926
Sequence length 5476
Comment pep:known_by_projection chromosome:UMD3.1:7:92510676:92699410:1 gene:ENSBTAG00000006031 transcript:ENSBTAT00000007926 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFFFFSIGMPSASLLVNLLSALFIPFVFGETEIRFAGQTEFVVNETSTTVIRLVVERIGD
PANVTAIVSLYGDDTGDFFDTYAATFIPFGETSRTVYIAVCDDDFPEPDETFIFHLTLQK
PSANVKLGWPRTVTVTILSNDNAFGIISFNMPFSITVSEPRGRNESVPLTLIREKGTYGM
VTVTFEVEGGPNPPEEDLSPVKGNITFPAGKATVVYNLTVLDDEVPENDEIFLIQLKSVE
GGAEINTSRSSVEIIIKKNDSPVRFIQNVYLVPEEDHILTIPVVRGKDDSGNLIGSDDCE
VSISYVIITGNSTAHAQQNLDFIDLQPNTTIVFPPFIYESHLKFQIVDDAIPEIAESFQV
VLLKDTLRGDAVLFGPSVVQVTIKPNDKPYGVLSFNSVLFERPVIIDEDTTTRFEEITVV
RNGGTHGNVSVNWVLTRNSSDPSPVTTDIRPRSGVLHFAQGQMLASIPLIVVNDDLPEEA
EAYLLQILPHTIRGGAEVSEPAELLFYIQDSDDVYGLITFFPVENQKIESSPGERCLSLS
LTRLGGTKGDVKIFYSALYIPAGAVDPLRAKDGILNISKRSSLIFPEQKTQVTIKLPIRN
DAFLQNGAHFLVQLEAVELVNIVPPIPPISPRFGEIQNISLVVTPDIANGEIGFISNLPI
ILHEPEDFAAEVVCIPLHRDGTDGQATVYWSLKPSGFNSKAVTLDDIGPFNGSVVFLSGQ
SDTTINITVKADDIPEMNETVTLSVDRVSVENQVLKSGYTSRDLIILENDDPGGVFEFSS
ASRGPYIIKEGESVELHIIRYRGALVKQFLHYRIEPRDSNEFYGNTGVLEFKPGEREIVI
TLLSRLDGIPELDEHYWVVLTSHGERESKLGSATVVNITILKNDDPHGIIEFVSDDLIVT
INESKGDNTCSAVYGVIRNRGTFGDVNVSWVVSPDFTHDVFPVRGTIFFGDQEFLKNITI
YSLPDEIPEEMEEFTITLLNATGGAKIGNITTATLRIRRNDDPIYFAEPRVVRVREGETA
DFKVLRNGSVDVPCTVQYATMDGEATAREGDFVPIEKGEMLVFTVGSREQNISVFIMEDD
IPETDEPFYIILFNSTGDTVVYPYATATVIIEANDDPNGIFALEPIDKAVEEGKTNSFWI
LRHRGHFGNVSVAWQLFQNDSALQLGQEFYETSGTVNFLDGEGAKPIILHAFPDKIPEFN
EFYILKLVNISGGSPGPGGQLAATNLQVTVMIPFNDDPFGVFILDPECLEREVAEDVLSE
DAMSYITNFTILRQQGAFGDVRVGWEILSSEFTAGLPPVTDFLLAGIFPSSVHLQPHMRR
HHSGTDALYFSGLEGAFGTVNPKYHPSRNNSIANFTFSAWVMPNPNTNGFVIAKDDGNGG
IYYGVKIHTNESHVTLSLHYKTLGSNATYVAKTTVMKYLEENVWLHLLIVLDDGIIEFYL
DGNAMPRGIKSLKGEAITDGPGTLRIGAGVNGNDRFTGLMQDVRSYEQKLTLEEIYELHA
MPAKSDLHPVSGYLEFREGETNKSFIISARDDNEEEGEELFILKLVSVYGGARLSEENTT
ARLVIQKSDNANGLCGFTGACIPEIAEEGSTISCVVERTRGALDYVHVFYTISQIESDGV
NYLVDDFANASGSITFLPWQRSEVLNIYVLDDDIPELNEYFRVTLVSAIPGDGKIGSTPT
SGASIDPEKETTDITIKASDHPYGLLQFSTGPPPQPEDTMTLPASGVPHVTVREEDGEVR
LLVVRAQGLLGRVMAEYRTVSLTAFSPEDYQSVAGTLEFQPGERFKYISVNITDNSIPEL
EKSFKVELLNLEGGVTELFRVDGSGSGDGDMEVFLPANRRHAGLGVASQILVTIAASDHA
HGVFEFSPESLVVSGTEPEDGYSTVIFNIMRSHGALSRVTLLWSIDSDPDGDLAFTSGNV
TFEIGQKRANITVEILPDEDPELDKAFSVTILSVSSGSLGVHTNATLIVLASDDPYGVFI
FSEKNRPIKVEEATQNITLSIIRLKGLLGKVKVTYATLDDMEKLPHFPPNLARATQGKDY
LPASGFAVFRANQSEATITVSVLDDDEPERSESLFVELLNSTLTEKVQNRPIPNSPRLGP
KVEAIAELIIIANDDAFGTLQLSAPVVRVAENHVGPIINVTRTGGTFADVSVKFKAVPIT
AVAGEDYSIASSDVVLLEGETSKAVPIYIINDIYPELEESFLVQLLNETTGGAKLGALTE
AIIIIEASDDPYGLFGFQITKLIVEEPEFNSVKVNLPIIRNSGTLGNVTVQWVATINGQL
ATGDLRVVSGNVTFAPGETIQTLLLEVLADDVPEIEEVIQVQLTDASGGGTIGLDRVANI
IIPANDNPYGTVAFVQSVSRVQEPLERSSCANITVRRSGGHFGRLLLFYGTSDIDVVALA
VEEGQDLLSYYESPIQGLPDPLWRTWVNVSAMGEPQDTCATLCLKEHACSAFSFLSASEG
PQCFWMTSWASPTANNSDFWTYKKNVTRVASLFSGQAVAGSDYEPVTRQWAIMLEGDEFA
NLTVSILPDDFPEMDESFLISLLEVHLMNITASFKNQPTIGQPNTSTVVIALNGDAFGVF
VIYSISPNTSEDGLYVEVQEQPQSTVEMVIHRTGGSLGQVTVEWRVVGGTATEGLDFIGA
GDILTFAEGETKKVAVLTILDDSEPEDDEIIVVSLVYTEGGSRILPSSDTVRVNILANDN
VAGVVGFQTTSRSVIGPEGEILQFHVIRTPPGRGNVTVNWKIIGQNLEFNFANSTGQLFF
PEGSLNKTISVHLLDDNIPEEKEVYQVILYDVRTQGVSPAGAALLDAQGYAAVLTVEASD
EPHGVLNFALSSRFVLLQEANTTVKLFINREFGSLGAVNVTYATVPGMLSRKNQTEGNLA
EPDVDFVPVVGFLILEEGETAGAIDITILEDDIPELEEYFLVNLTHVELIMAPFTSFPPR
LDSEGLTAQIIIDANDGARGIIEWRQSRFEVNETQGSLTLVAQRRTGALGHVSLFVYAQN
LEAQLGVDYAFTPMILHFANGERYKNVDIMILDDDIPEGDEAFQLILTNPSPGLELGENI
IAFVTILANDDGPGVLSFNNSEHFFLREPTAVYIQESMAVLYVIREPAQGLFGTVTVQFI
VTEVNSSMESKDLTPSKGYVVLEEGVRFKALHISAILDTEPEMDEHFVCTLFNPTGGARL
GAHVQTLITVLQNQAPLGLFSISAVANRATSVSIEEANRTVYLSVSRTNGIDLAVSVEWE
TVSETAFGMRGMDVMFSMFQSFLEASASGWCFFTLEDSVHGLMLRKLSSTLYRWQGIFVP
FEDLSIENPKTCEAFNIGLSPYFVITHEERNEEKSSVNSVYTFTSGFKLFLVQRINISES
SQVRYFTSDSQDYLIVASQSDDSQLTQVFRWNGGSFVWHQTLSVRGVLSMALFTRGGAVF
LAIAQANARSNSLLLRWSSNEFTNFQEVPISGTTQVEALTSGDDIYLIFAKAIFLGDQNS
VDIFVWEAGQSSFRYFQSLDFAAVNKIHSFTAASGIVHLLLLGQAVSALYCWNSELNHFS
FLLEAPSAYDAAFVTVKSLNSSKNLIALAGATHSHIYELAYVSSQSDFIPSSGELIFEPG
DKEAIIAVNVLDDTVPEEDESFRVQLKNPKGGAEIGINGYVQITILSNDDAYGVVGFAQN
SLYKQVEEMEQDSLVTLNVERLKGTYGRITVAWEADGSISDIFPTSGVISFSEGQALSTI
TLTVLADDLPELSEIVIVTLIRIITEGVEDPSKGATIDQKRNKSVITTLPNDSPYGLVGW
HAESLFIKVAEPKENVTALQLQIVRDKGLLGDIAIQLVAKPNFLLHINNQATENKDYVLQ
ETMIIMKENIKETYVKVAILPDDVPELEEGFIVSITEVRLVNSDFSAGQPSVRRPGLEMA
EIMIEENDDPRGIFKFHVTRDVGVITAYEVPPPLNVLQIPVVRLAGSFGAVKVYWKATVD
SAGLEDFKPSHGILEFADRQVTAVIEITIIDDDEFELLEMFNISLIKAAGGGRLGDDVVV
TVVIPQNDSPFGVFGFEEKTVMVDESLLSDDPDSYVTLTVVRSPGGKGAVRLQWTLDEMA
KDDLSPLSGTLHFNETESQKTIVLHTLQDATLEEDRRFTIQLLSVDEVEISPVKGSASII
IRGDKGASGEVGIAPSSRHVLIGEPSAKYNGTAIISLIRGPAISGEVTVSWRIVPPSLEE
FAETSGKLTMRDGQSAAVVVIQALNDDLPEEKRFYEFQLTEVSEGGVLSESSTTATITVV
ASDFPYGRFAFSQEQLRVTEEIQKVNLTVIRSGGSFGRVRLCLEAVSGTAEVGVDFLPPP
VQLLFEAKETVKIVHIEILDDSLPEGPEEFSLMMTEVELLGSFYDFARGYDFTIQENGLQ
IDQPPEIGNISIVRIIIMKNDNAEGIIEFDPRYTTFEVEEDIGTIMIPVQRLHGTYGRVT
ADFVSQSSSAVPGGVDYVLHGSSVTFQHGQNLSFINVSIIDDDESEFEEPIEIMLIGATG
GAVLGRHLVCRITIAKSDSPFGVIRFLNQSRVSVPNPNSTMILPLMLERTGGLLGEIQVN
WEIVGPNSQEALPSQNRDIADPVSGSFSFGDGEGGMRSIILVIYPHDDIEIEKTFIIKLE
LVRGEAQLDSTANDVTLTIEKFGDPNGVIQFAPESLSEETYLEPSTLEGPLIITFFVRRI
KGVSGEIMVYWELSSEFDITGDFLSTKGSFTIADGESEASFDVHLLPDDIPEIEEVYVLQ
LVLVKGGAKLDTEKCVIRFSVSANDDPHGIFALYSDHQSILIGQNLRRFIQINVTRLAGT
FGDVAVRYRISSDSKEQSVVTENAERQLVVRDGTRYKVDSVPVQSQVFLPLGSNFTLQLV
TVMLVGGSFYGVPKILQEAKSAVLPVPEKAANSQVGFEFTAFPLTDIAAGTSQAVISRRG
TYGSLKVSWAAGYVPGSEIPEFTTVGNMTPKVGRLSFSHGEESKRVLLWTHPSPGRLEAF
VVHLSGVQSSVPGGAQLRSGFIVAEIEPMGVFQFSPSSRNIIVSEDTQMIRLHVQRLFGF
HGELIKVSYQTAAGRAKPQKDFEPVQNGELLFQKFQVEVDFEIIIIDDELPEIEEIFYIN
LTSVEIQGLPKFDANWRPRLNQDFSVAVITILDNDDLAGTDTSFAKTAVTTAVDTALPLE
TDSATTHPDTTEITAIPQPTEVVAVVTEVAGVPPIPENLVTLAGTSATSEKPNAATVTTD
TSVHGTFSLGPPVVYIEEEMENGTLNAAEVLVRRTGGSAGNVSVTVRTFGERSAQKEPNT
LPFPDRHGISNLTWATEEEDFKAQTLILAFVDGERERKVSIAILDDGDPEGQEFFYVFLT
DPQGGAQIVKGEDDAGFADFAMIIITGSDLHNGIIGFSEESQSRLELGEETETSSLHLTV
TRQPNRAFEDVEVFWRVTFNKTAAVLQKDGVNLADELLSVSGTTVCRAGQTECFISIELK
PGKVRNNEARYFVDTY
Download sequence
Identical sequences F1N0A6
ENSBTAP00000007926 ENSBTAP00000007926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]