SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000007931 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000007931
Domain Number 1 Region: 28-103
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000502
Family Growth factor receptor domain 0.0034
Further Details:      
 
Domain Number 2 Region: 98-164
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000157
Family VWC domain 0.043
Further Details:      
 
Domain Number 3 Region: 193-237
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000129
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000007931   Gene: ENSBTAG00000006037   Transcript: ENSBTAT00000007931
Sequence length 250
Comment pep:known_by_projection chromosome:UMD3.1:13:73833119:73847404:1 gene:ENSBTAG00000006037 transcript:ENSBTAT00000007931 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGTFQTHLLAFSLLCLLSKVCAQLCPTPCACPWPPPRCPPGVPLVLDGCNCCRVCARRL
GEPCDHLHVCDPSQGLVCQPGAGPGGRGAVCLWGEDDGSCEVNGRLYRDGETFQPHCRLR
CRCEDGGFTCVPLCSEDVRLPSWDCPHPRRVEVPGKCCPEWVCDQGVGLGVQPLPAQGSQ
FSGLVAPPAPGVPCPEWSTAWGPCSTTCGLGVATRVSNQNRFCRLETQQRLCVLGPCPPA
RGHSPRSRAF
Download sequence
Identical sequences F1N0A1
ENSBTAP00000007931 ENSBTAP00000007931 XP_005214836.1.76553 XP_010809806.1.76553 9913.ENSBTAP00000007931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]