SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000007967 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000007967
Domain Number 1 Region: 127-255
Classification Level Classification E-value
Superfamily DNA clamp 3.43e-47
Family DNA polymerase processivity factor 0.00000038
Further Details:      
 
Domain Number 2 Region: 1-126
Classification Level Classification E-value
Superfamily DNA clamp 2.6e-42
Family DNA polymerase processivity factor 0.000000541
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000007967   Gene: ENSBTAG00000006065   Transcript: ENSBTAT00000007967
Sequence length 261
Comment pep:known chromosome:UMD3.1:13:47788530:47794602:-1 gene:ENSBTAG00000006065 transcript:ENSBTAT00000007967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTY
RCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMD
LDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNI
KLSQTSNVDKEEEAVAIEMNEPVQLTFALRYLNFFTKATPLSPTVTLSMSADVPLVVEYK
IADMGHLKYYLAPKIEDEEGS
Download sequence
Identical sequences G1NW67 L8HW73 Q3ZBW4
ENSMLUP00000001552 9913.ENSBTAP00000007967 ENSBTAP00000007967 ENSBTAP00000007967 ENSMLUP00000001552 NP_001029666.1.59421 NP_001029666.1.76553 XP_005874733.1.60319 XP_005906590.1.15283 XP_006096495.1.53796 XP_008139287.1.99482 XP_010834739.1.44457 XP_010853013.1.44457 XP_019828920.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]