SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000007978 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000007978
Domain Number 1 Region: 19-124
Classification Level Classification E-value
Superfamily L domain-like 1.25e-26
Family Ngr ectodomain-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000007978   Gene: ENSBTAG00000006072   Transcript: ENSBTAT00000007978
Sequence length 306
Comment pep:known chromosome:UMD3.1:19:36915567:36927313:1 gene:ENSBTAG00000006072 transcript:ENSBTAT00000007978 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKAGSKGGNLRDKLDGNELDLSLSDLNEVPVKELAALPKATVLDLSCNKLTTLPSDFCG
LTHLVKLDLSKNKLRQLPADFGRLVNLQHLDLLNNRLVTLPVSFAQLKSLKWLDLKDNPL
DPVLAKVAGDCLDEKQCKQCANKVLQHMKAVQADQERERQRRLEIDREAEKKWEAKQRAK
EAQERELRKREKAEEKERRRKEYDALKAAKREQEKKPKKETNQAPKSKSSSRPRKPPPRK
HTRSWAVLKLLLLLLLCVAGGLVACRVTELQQQPLCTSVNTIYDNAVRGLRSHDILQWVL
QTDSQQ
Download sequence
Identical sequences Q5E9X4
ENSBTAP00000007978 ENSBTAP00000007978 9913.ENSBTAP00000007978 NP_001029750.1.59421 NP_001029750.1.76553 XP_006041216.1.26621 XP_010841091.1.44457 XP_019836610.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]