SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000008069 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000008069
Domain Number 1 Region: 920-1203
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.14e-27
Family Quinoprotein alcohol dehydrogenase-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000008069   Gene: ENSBTAG00000006132   Transcript: ENSBTAT00000008069
Sequence length 1203
Comment pep:known_by_projection chromosome:UMD3.1:14:3750706:3793653:-1 gene:ENSBTAG00000006132 transcript:ENSBTAT00000008069 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KRSFRKKRERPRVELGKGVPGGPRGPDPEDVNIPNGVDLLALPQLCFPGGLCVASEPRED
CVHFLVLTDICGNRTYGVVAQYYRPLHDEYCFYNGRTHWEALGPGGSAAGCFVPFAVCVV
SRFPYYNALKDCLSCLLTHLKFCKDFEVDNHIKDFAAKLSLIPSPPPGPLHLIFNMKPLQ
IVFPSRADPESPLIDLDLHLPLLCFRPEKVLQILSCLLTEQRVVFFSSSWALLTLVAECF
MAYLHPLQWQHTFVPILSGQMLDFLMAPTSFLMGCHLDHFEEVSKEADGLILINIDSGNI
TYSNDEEVDVPDIPLLAAQTFIQRVQSLQLHHELDLAHLCASTDVNEGRASRRAWQQQLN
CQIQQMTLQLLVSIFREVKNHLNYEHRVFNSEEFLKTRALGDQQFYKQVLDTYMFHAFLK
ARLSRRMDAFAQMDLHTQSEEDRINGMLLSPRRPTIEKMASRKSSVSHTAHRRMVVSMPN
LQDITVPELPPRNSSLRKIQTTEYGSSHTVLDVPPKSTHTFKIPEIHFPLVAQCVQAFYA
DCVAQLSKAMGSLAPENSVLLARYFYLRGLVQLMQGQLLDALLDFQSLYKTDVRVFPTDL
VQTTVESLSAPERTQAERMPELRRLISEVMDRPADVPKADDRVKNFELPKKHMQLDDFVK
RVQESGIVKDTVIIHRLFEALTVGHEKQIDPETFKDFYNCWKEAEAEAQEVSLPLSVMEQ
LDKSECVYKLSRSVKTNRGVGKIAMTQKRLFLLTEGRPGYVEISTFRNIEDVRSTMATFL
LLRIPTLKIKTTSKKEVFEANLKTECDLWHLMVKEMWAGRKLADDHKDPQYVQQALTHIL
LMDAVVGTLQSPGAIYAASKLSYFDRMKNEMPMAIPKTTSETLKHKINPSEGETTPRAVD
VLLYTPGHLDPAEKVEDAHPKLWCALNEGKVIVFDASSWTIHQHCFRVGTSKLNCMVMAE
QSQVWVGSEDSVIYIINVHSMSCNKQLTDHRSSVTGLAVQDGEQAPSTVYSCSADGTVLA
WNASSLRVTGRFQVPGGGLSAIRLHGGRLWCCTGDSILMVNMNGSSCQKLKITGSFKETG
TSFLGFQLMPEQEQLWAACAGYPDVYVWSLQDPAQPPQRIHLQDCSEINCMIRVKKQIWV
GTTGLSQGQLKGKIYVMDAERRTVEKELVAHADTVKTLCSAEDRYVLSGAGPEEGKIAIW
KVE
Download sequence
Identical sequences F1MLZ5
ENSBTAP00000008069 ENSBTAP00000008069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]