SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000008120 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000008120
Domain Number 1 Region: 6-161
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.42e-25
Family L-arabinose binding protein-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000008120   Gene: ENSBTAG00000006176   Transcript: ENSBTAT00000008120
Sequence length 191
Comment pep:known chromosome:UMD3.1:15:2115247:2138300:-1 gene:ENSBTAG00000006176 transcript:ENSBTAT00000008120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GFKDISLERFIHGGANVTGFQLVDFNTPMVTKLMDRWKKLDQREYPGSETPPKYTSALTY
DGVLVMAETFRSLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLKQVQIQGLTGNVQ
FDHYGRRVNYTMDVFELKSTGPRKVGYWNDMDKLVLIQDVPTLGNDTAAIENRTVVVTTI
MPLMKNPILRN
Download sequence
Identical sequences F1MNP9
ENSBTAP00000008120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]