SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000008159 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000008159
Domain Number 1 Region: 56-162
Classification Level Classification E-value
Superfamily SRCR-like 5.49e-38
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00015
Further Details:      
 
Domain Number 2 Region: 432-549
Classification Level Classification E-value
Superfamily SRCR-like 6.8e-25
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0015
Further Details:      
 
Domain Number 3 Region: 325-425
Classification Level Classification E-value
Superfamily SRCR-like 3.4e-24
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00042
Further Details:      
 
Domain Number 4 Region: 201-303
Classification Level Classification E-value
Superfamily SRCR-like 8.37e-22
Family Scavenger receptor cysteine-rich (SRCR) domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000008159   Gene: ENSBTAG00000006214   Transcript: ENSBTAT00000008159
Sequence length 773
Comment pep:known chromosome:UMD3.1:8:71278583:71349786:-1 gene:ENSBTAG00000006214 transcript:ENSBTAT00000008159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERRGSSCLCRCLALLALLPTLSLAQYESWRHYPEYFQEPAPEYHRPEVPSDVAKIQLRL
AGQKRKHSEGRVEVYYDGQWGTVCDDDFTIHAAHVVCRELGYVEAKSWTASSSYGKGEGP
IWLDNVYCTGSEATLAACSSNGWGVTDCKHTEDVGVVCSEKRIPGFKFDNSLINSIENMN
IQVEDIRIRAILSAFRKRTPVTEGYVEVKEGKTWKQICDKHWTAKNSRVVCGMFGFPGEK
TYNTKVYKMFAARKKQRYWPYSMDCTGTEAHISSCKLGPQVSLDPVKNVTCENGLPAVVS
CVPGQVFSPDGPSRFRKAYKPEQPLVRLRGGANVGEGRVEVLKNGEWGTVCDDKWDLVSA
SVVCRELGFGSAKEAITGSRLGQDIGPSPCRKECTGREKSTFDVKSWAESRRCSRREEAE
LQCETPGTSFIPQLRLNGGRNPYEGRVEVLVERNGSLVWGMVCGENWGIVEAMVVCRQLG
LGFASNAFQETWYWHGNINANKVVMSGVKCSGTELSLAHCRHDGEDVACPEGGVRYGAGV
ACSETAPDLVLNAEIVQQSTYLEDRPMFMLQCAMEENCLSASAAQTNPTTGYRRLLRFSS
QIHNNGQSDFRPKNGRHAWIWHDCHRHYHSMEVFTHYDLLNLNGTKVAEGHKASFCLEDT
ECEGDIQKSYECANFGEQGITMGCWDMYRHDIDCQWVDITDVPPGDYLFQVVINPNYEVA
ESDYTNNIMKCRTRYDGHRIWMYNCHIGGSFSEETEKKFEHFSGLINNQVSKR
Download sequence
Identical sequences M0QVZ4
ENSBTAP00000008159 ENSBTAP00000008159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]