SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000008184 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000008184
Domain Number 1 Region: 36-460
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.15e-119
Family L-arabinose binding protein-like 0.000000000000837
Further Details:      
 
Domain Number 2 Region: 864-1055
Classification Level Classification E-value
Superfamily Nucleotide cyclase 4.4e-67
Family Adenylyl and guanylyl cyclase catalytic domain 0.0000425
Further Details:      
 
Domain Number 3 Region: 562-845
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.23e-53
Family Protein kinases, catalytic subunit 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000008184   Gene: ENSBTAG00000006234   Transcript: ENSBTAT00000008184
Sequence length 1064
Comment pep:known chromosome:UMD3.1:3:16747641:16761172:-1 gene:ENSBTAG00000006234 transcript:ENSBTAT00000008184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPAEAMPRPGRPSGARLRLLLLLPPLLLLPGSYAGNLTVAVVLPLTNTSYPWSWARVGP
AVELALARVKARPDLLPGWTVRTVLGSSESALGVCSDTAAPLAAVDLKWEHSPAVFLGPG
CVYAAAPVGRFTAHWRVPLLTAGAPAVGFGAKDEYALTTRAGPSHAKLGDFVAALHRRLG
WERQALVLYAYQPGDDQPCFFVVEGLYMRVRDRLNITVDHLEFAEGDRDHYTMLLRTVRR
KGRVIYICSSPDTFRALMLLALEAGLSGNDYVFFHLDLFGQSLQGAHGIAPRRPWERGDG
QDVSAHQAFRAAKIITYKEPDNPEYLEFLQKLKRLALEQFNFTMEDGLVNTIPASFHDGL
LLYIQAVTETLAHGGAVTDGEGITQRMWNRSFQGVTGYLKMDSNGDRETDFSLWDMDPNT
GAFRVVLNFNGTSQELMTMSGCKLNWPLGYPPPDVPKCGFDNEDPACNQDHFSTLEVLAL
VGSLSLLSILIVSFFIYRKMQLEKELASELWRVRWEDLQPSSLERHLRSAGSRLTLSGRG
SNYGSLLTTEGQLQIFAKTAYYKGNLVAVKRVNRKRIELTREVLFELKHMRDVQNEHLTR
FVGACTDPPNICILTEYCPRGSLQDILENESITLDWMFRYSLTNDIVKGMLFLHNGAICS
HGNLKSSNCVVDGRFVLKITDYGLESFRDPEPEQGHTLYAKKLWTAPELLRMASPPARGS
QAGDVYSFGIILQEIALRSGAFHVEGLDLSPKEIIERVTRGEQPPFRPSLALQSHLEELG
QLMQRCWAEDPQERPPFQQIRLMLRKFNRENSSNILDNLLSRMEQYANNLEELVEERTQA
YLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQV
VTLLNDLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGRLHAREVARMALALLDAVR
SFRIRHRPQEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHLS
SETKAVLEEFGGFELELRGDVEMKGKGKVRTYWLLGERGSSTRG
Download sequence
Identical sequences E1BN71
ENSBTAP00000008184 NP_001179680.1.59421 NP_001179680.1.76553 ENSBTAP00000008184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]