SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000008298 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000008298
Domain Number 1 Region: 421-910
Classification Level Classification E-value
Superfamily ALDH-like 3.14e-161
Family ALDH-like 0.000000000668
Further Details:      
 
Domain Number 2 Region: 9-209
Classification Level Classification E-value
Superfamily Formyltransferase 9.16e-50
Family Formyltransferase 0.0000000219
Further Details:      
 
Domain Number 3 Region: 213-313
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 1.13e-25
Family Post formyltransferase domain 0.0000153
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000008298   Gene: ENSBTAG00000006326   Transcript: ENSBTAT00000008298
Sequence length 911
Comment pep:known chromosome:UMD3.1:5:68883546:68928003:-1 gene:ENSBTAG00000006326 transcript:ENSBTAT00000008298 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQVCFKNKLKVALIGQSLFGQEVYSHLCKEGHRVVGVFTVPDKDGKADPLALAAEKNGTP
VFKFPRWRVKGKTIKEVAEAYRSVGAELNVLPFCTQFIPMDVIDGPKHGSIIYHPSILPR
HRGASAINWTLIMGDKKAGFSVFWADDGLDTGPILLQRSCDVEPNDTVDALYNRFLFPEG
IKAMVEAVQLIADGKAPRIPQSEEGATYEGIQKKENAKISWNQSAEALHNWIRGHDKVPG
AWAEINGQVVTFYGSSLLNSSVPPGEPLEIKGAEKPGLVTKNGLVLFGNDGKALMVRNLQ
FEDGKMIPASQYFSSGEMSMVELTAEEVKVAETIKVIWAGILSNVPAIEDSTDFFKSGAS
SMDVARLVEEIRQKCGGLQLQNEDVYMATKFEDFIQKVVRKLRGEDQEAELVVDYVSKEI
NDMTVKMPYQCFINGQFTDAEDGQTYDTINPTDGSTICKVSYASLVDVDKAVAAAKDAFE
NGEWGRMNARDRGRLMYRLADLMEEKQEELATIEALDSGAVYTLALKTHIGMSVQTFRYF
AGWCDKIQGSTIPINQARPNRNLTFTKKEPLGVCAIIIPWNYPLMMLAWKSAACLAAGNT
LVLKPAQVTPLTALKFAELSVKAGFPKGVINIIPGSGGVVGQHLSEHPDIRKLGFTGSTL
IGKQIMKSCAMSNLKKVSLELGGKSPLIIFSDCELDKAVRMPKGMGAVFFNKGENCIAAG
RLFVEESIHDEFVTRMVEEIKKMKIGDPLDRSTDHGPQNHKAHLEKLLQYCEAGVKEGAT
LVYGGRQVQRPGFFMEPTVFTDVEDHMYLAKEESFGPIMVISKFQNGDVDGVLQRANNTE
YGLASGVFTRDINKAMYVSEKLEAGTVFINTYNKTDVAAPFGGFKQSGFGKDLGEEALNE
YLKTKTVTLEY
Download sequence
Identical sequences E1BDG9
ENSBTAP00000008298 ENSBTAP00000008298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]