SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000008348 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000008348
Domain Number 1 Region: 275-620
Classification Level Classification E-value
Superfamily L domain-like 2.24e-44
Family Ngr ectodomain-like 0.0068
Further Details:      
 
Domain Number 2 Region: 29-229,279-380
Classification Level Classification E-value
Superfamily L domain-like 2.81e-35
Family Ngr ectodomain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000008348   Gene: ENSBTAG00000006360   Transcript: ENSBTAT00000008348
Sequence length 661
Comment pep:known_by_projection chromosome:UMD3.1:20:12352171:12366624:1 gene:ENSBTAG00000006360 transcript:ENSBTAT00000008348 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPCVSCFLLAVLISAGCKAIPSSDPKCTEKEGNRTYNCENLGLREIPDTLPNTTEVLEF
SFNFLPTIQNTTFSRLINLIFLDLTRCQINWVHEDTFQSHHQLNTIVLTGNPLIFMAETS
LTGPKFLKHLFLTQTGISNLEFIPVHNLENLESLHLGSNHISSINLPENFPTQNLKVLDF
QNNAIHYISRKDTNSLEQATNLSLNFNGNDIKGIEPGAFSSKIFQSLKFGGSLNLFIIFK
GLQNSTLQSLWLGTFEDTDDQYLTSATFEGLCDMSVESINLQKHRFSDLSSSTFRCFTRV
QELDLTAAHLNGLPSGIEGMNSLKKLVLNANSFDQLCQINAASFPSLRDLYIKGNMRKLD
LGTRCLEKLENLQKLDLSHSDIEASDCCNLQLKNLRHLQYLNLSYNEPLGLEDQAFKECP
QLELLDVAFTHLHVKAPHSPFQNLHLLRVLNLSHCLLDTSNQHLLAGLQDLRHLNLQGNS
FQDGSISKTNLLQMVGSLEILILSSCNLLSIDQQAFHGLRNVNHLDLSHNSLTGDSMDAL
SHLKGLYLNMASNNIRIIPPHLLPALSQQSIINLSHNPLDCTCSNIHFITWYKENLHKLE
DSEETTCANPPSLRGVKLSDVKLHCGITGVGIFFIVVFVFLLILLLIFSVKFILRWKYQH
I
Download sequence
Identical sequences F1MFI2
9913.ENSBTAP00000008348 ENSBTAP00000008348 ENSBTAP00000008348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]