SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000008354 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000008354
Domain Number 1 Region: 631-919
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.55e-79
Family Protein kinases, catalytic subunit 0.0000000432
Further Details:      
 
Domain Number 2 Region: 29-204
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.45e-55
Family Ephrin receptor ligand binding domain 0.0000129
Further Details:      
 
Domain Number 3 Region: 335-540
Classification Level Classification E-value
Superfamily Fibronectin type III 7.75e-22
Family Fibronectin type III 0.0028
Further Details:      
 
Domain Number 4 Region: 914-981
Classification Level Classification E-value
Superfamily SAM/Pointed domain 4.91e-20
Family SAM (sterile alpha motif) domain 0.0011
Further Details:      
 
Domain Number 5 Region: 263-332,367-396
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000746
Family Growth factor receptor domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000008354   Gene: ENSBTAG00000006359   Transcript: ENSBTAT00000008354
Sequence length 982
Comment pep:known_by_projection chromosome:UMD3.1:4:107608325:107623775:-1 gene:ENSBTAG00000006359 transcript:ENSBTAT00000008354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERRWPLGLGLLLLLLLCAPLPPGARAEEVTLMDTSMAQEELGWLLDPPEDGWSEVQQIL
NGTPLYMYQDCPVQEGRDTDHWLRTNWIYRGEEASRVHLELQFTVRDCKSFPGEGGPLGC
KETFNLLYMESDQDVGIQLRRPLFQKVTTVAADQSFTIRDLASRAVKMNVERCSLGRLTR
RGLYLAFHNPGACVALVSVRVFYQRCPETVHGLARFPNTLPGPGGLAEVAGTCLPHAHIS
PGPSGAPRMHCSPDGEWLVPVGRCHCEPGYEEGSSDVEECLACPSGSYRSDVDAPQCLRC
PQHSTAEAEGATECACESEHYRAPGEGPHAACTRPPSIPRNLSFSVSGTQLSLRWEPPAD
LGEREDVTYNVECSQCQGAALDGGPCQPCGAGVRFSAGPSGLTACSVRVDGLDPHANYTF
NVEAQNGVSGLGASRPASASLSINMGSAESLSGLSLRLVKKAPRQLELTWAGSRPRSPGG
NLSYELHVLNQDEERYQMVLEPRVLLTELQPDTTYIVRVRMVTPLGPGPFSADHEFRTSP
PVSRVLTGGEIVAIIFGLLLGVALLLGMLLFRSRRAQRRRHQRQQRQRDRVADGDREDKL
WLKPYVDLQAYEDPAQGALDFTQELDPAWLVVDTVIGEGEFGEVYRGSLRLPSQDGKIVA
IKTLKDTSPEGQWWNFLREATIMGQFNHPHILHLEGVVTKRKPIMIITEFMENGALDAFL
REREDQLVPGQLVAMLQGIASGMNYLSDHNYVHRDLAARNILVSQNLCCKVSDFGLTRLL
DNFDGTYETQGGKIPIRWTAPEAIAHRIFTTASDVWSFGIVMWEVLSFGDKPYGDMSNQE
VMKSIEDGYRLPPPVDCPAPLYELMKNCWAYDRVRRPTFHRLKAQLEHLHANPHSLRTIA
NFDPRVTLRLPSLSGSDGIPYRSVAEWLESIRMKRYILHFRSAGLDTMECVLDLTAEDLV
QMGITLPGHQKRILYSIQGFKD
Download sequence
Identical sequences F1MFH7
NP_001137567.1.59421 NP_001137567.1.76553 ENSBTAP00000008354 ENSBTAP00000008354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]