SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000008357 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000008357
Domain Number 1 Region: 32-107
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000157
Family Growth factor receptor domain 0.0057
Further Details:      
 
Domain Number 2 Region: 95-166
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000445
Family Fibronectin type I module 0.023
Further Details:      
 
Domain Number 3 Region: 198-242
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000109
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000008357   Gene: ENSBTAG00000006367   Transcript: ENSBTAT00000008357
Sequence length 349
Comment pep:known chromosome:UMD3.1:9:70873221:70876455:-1 gene:ENSBTAG00000006367 transcript:ENSBTAT00000008357 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSATGLGPVRCAFVLLLALCSRPASSQDCSAPCQCPAGPAPRCPAGVSLVLDGCGCCRVC
AKQLSELCTERDPCDPHKGLFCDFGSPANRKIGVCTAKDGAPCVFGGTVYQSGESFQSSC
KYQCTCLDGSVGCVPLCSVDVRLPSPDCPFPRRVKLPGKCCEEWVCDEPKEHTVVGPALA
AYRPEDTFGPDPTMIRANCLVQTTEWSACSKTCGMGISTRVTNDNAFCRLEKQSRLCMVR
PCEADLEENIKKGKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTT
LPVEFKCPDGEVMKKSMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA
Download sequence
Identical sequences O18739
XP_006077059.1.26621 9913.ENSBTAP00000008357 ENSBTAP00000008357 ENSBTAP00000008357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]