SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000008454 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000008454
Domain Number 1 Region: 21-171
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.68e-43
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00032
Further Details:      
 
Domain Number 2 Region: 329-508
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.5e-35
Family Laminin G-like module 0.0039
Further Details:      
 
Domain Number 3 Region: 773-952
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.92e-35
Family Laminin G-like module 0.0018
Further Details:      
 
Domain Number 4 Region: 145-328
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.3e-34
Family Laminin G-like module 0.004
Further Details:      
 
Domain Number 5 Region: 959-1165
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.24e-27
Family Laminin G-like module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000008454   Gene: ENSBTAG00000006446   Transcript: ENSBTAT00000008454
Sequence length 1280
Comment pep:known chromosome:UMD3.1:8:66382783:66625740:1 gene:ENSBTAG00000006446 transcript:ENSBTAT00000008454 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFLLSAQPWSTLAEGNTYNCDAPLASSLPRASFTSSSELSSSHGPGFASLNRRDEKGAG
GWSPLVSNKYQWLQIDLGERMEVTAVATQGGYGSSDWVTSYLLMFSDGGRNWKQYRREES
IWGFPGNTNADSVVHYRLQPTFEARFLRFLPLTWNPKGRIGMRIEVYGCAYRSEMVHFDG
KSSLLYTFNHKSMNPIKEVISLKFKTRENNGILLHREGPNDKHITLELVKGKLILFLNSG
HADLPSPDALMLGSLLDDEHWHSVLIELLSTDVNFTVDTHTHHFRAKGESSYVDLDYKIS
FGGIPGHGKSVAFPHKNFHGCFENLYYNEVDIIDLSKKHKPQVLIMGNVSFSCSHTQTVP
MTFLSSRSYLVLPGISREDKVSVIFQFRTWNRAGLLLTSQFHHRSGALILVLSDGKLKLS
LSQPGHPARDITAGAGLNDGQWHSVSLSARGNHLSVMVDGEAASMAHSLRGQIESGDTYY
LGGCPDNSSHPGCTNSLGGFQGCLRLISIGDEAVDPISIQQGALGSFRDLQIDTCGLTDS
KQLPQYKDFEGNSCDPWISKNCLEQDYTNHTCHVAIYQLSLEKYRKKSQLSKMFYLDTNG
RNPGGEWEKMLKCKMSTDTAWTSVQHNGSHLVKIKSLNGESPHPVFFKYIASMDQLQTII
DYADNCQQELTFHCKKSRLSTPQDGTPVSWWVGRTNETHTYWGGSQPDAQKCTCGLEGNC
IDSQYYCNCDADRNEWTSNTVVLSHRKHLPVTQIVMRDTGQPHSEAAYSLGPLLCSGDNS
FWNSASFNTETSYLHFPTFRGELSADVSFFFKTTASSGVFLENLGITDFIRLELRAPTEV
TFSFDVGNGPCEVTVQSPTAFNDNRWHHVKADRNIKEASLQVGQHPRKTQPASADGHARL
QLNSQLFVGGTASRQRGFLGCIRSLRLNGLALDLEERAMMTPGVEPGCPGHCSTYGHLCH
NGGRCREKRRGITCDCTVSAYDGPFCENDISAYFGAGSSVIYNFQDHYNDTFSKNSSSFA
ALFHEDLTLTGEMATLSFRTTGTPSLLLYVSSFYEEYLSVILAPNGSLQIRYKLDRHREP
DVFNFGFKNLADGQLHHVRINREAAVMFVEVNQNARRQVILSSGTEFNAVKSLMLGTVLE
PLGADPDTLRAGARGFTGCLSAVRFGPAVPLKAALRSGGHSQVTVRGHVATASRCADGAR
PGAPAREATRPLAGGAGRSGPTDEGRPLVNADRSDSAVIGGVIAVVIFILLCITAIAIRI
YQQRWLYQKNETNIPKTGDN
Download sequence
Identical sequences F1MES2
ENSBTAP00000008454 ENSBTAP00000008454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]