SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000008532 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000008532
Domain Number 1 Region: 438-1001
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.35e-135
Family alpha-mannosidase, C-terminal domain 0.0000456
Further Details:      
 
Domain Number 2 Region: 18-348
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.73e-98
Family alpha-mannosidase 0.0000142
Further Details:      
 
Domain Number 3 Region: 351-452
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 6.87e-22
Family alpha-mannosidase, domain 2 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000008532   Gene: ENSBTAG00000006508   Transcript: ENSBTAT00000008532
Sequence length 1004
Comment pep:novel chromosome:UMD3.1:6:104408001:104453232:1 gene:ENSBTAG00000006508 transcript:ENSBTAT00000008532 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSVLTQLLLLWLLGTQPEATIRVFVVPHSHLDVGWLHTVQGSTQAYVTTVYTSVVEDLT
RNKQHRFIIVDQEFFRLWWDGVASAKQKVQVRQLVDQGRLEFVLGGQVMHDEAVTHVDDQ
ILQLTEGHRFLYETFGIRPQFSWQVDSFGASATTPTLFALAGFNGHIISRIDYDLKETMQ
QDQEMQFVWRGSRSLLAQQEMFTHVLDENGYCSKNNISLLLSKGFYWNEKAVFPDPPWDG
MYPNQTVPVTLSNIQRYANTLSYNVRKRAPWFLTPHILWPWGCDRQFFNASVQFANMDYL
MGYINKHVSQFGVLMVYATLSEYFQTLHSEHEPVQVRDHRDFLPYSSDMFHSWTGFYASR
SGLKGLARRASALLYAGESMFTRFMLAPHRFLDRAWGLQQLQKLRWAVSEVQHHEAITGA
HTPKVSDMFVGRLNNGMHGVQKLMSAIVQDRFPAHTEKRASGTSLEPGGYVAVIYNPLVW
TVTTIVTLTVDFPKVSVTDESGHPVPAQVQNSKEMPSVYDLLVLTTIPGLSYQYYVIKPS
RRAKGDTQVTEATMANTKQFGRRPRRHDSSVGRRLVHVENDCYTVFLDKDTNLMQSIWER
QSNQTIQVTQQFMEYEANGDEDQGPISDNYVFTSSETAKPAWETVGMEIVEGELVTEIRQ
YFYRTVNDRDPTYTVYSRLARGPPGADGELLCHRIEQEYRVGPLELNREAIWRTSTNLNT
ARVLYSDNNGYQVQRRAYKHHENNIARNYYPMTQSAFIQDRQSRLVLLSEQAHGVSSQGS
GQMEVMLHRRLLIKQQWALSVNVTLNDTSVVHSVLWLLLGPSTLTRDLGQRSGVALQHRP
VVLIRELSETARIHPHPQHQEAVTLPPSIHLQILSIPGWTYNSNHTKHVKNLRKDNKGEA
KAEFRRVLLRLHHLYEADEDPVRSQPVTVNLQSVLQGLGSVVSVEERSLTGTWDVSTLHR
WRWPTQEPGYLRGNSSHPSLHPGSFTITIHPKEIRTFFIYFKER
Download sequence
Identical sequences E1BHP0
ENSBTAP00000008532 ENSBTAP00000008532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]