SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000008629 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000008629
Domain Number 1 Region: 637-747
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-24
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 2 Region: 455-576
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.11e-17
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Domain Number 3 Region: 754-819
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000148
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 4 Region: 813-875
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000723
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 5 Region: 881-940
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000121
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 6 Region: 286-402
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000314
Family Spermadhesin, CUB domain 0.0063
Further Details:      
 
Domain Number 7 Region: 401-462
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000431
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 8 Region: 576-640
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000958
Family Complement control module/SCR domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000008629   Gene: ENSBTAG00000006569   Transcript: ENSBTAT00000008629
Sequence length 1033
Comment pep:known_by_projection chromosome:UMD3.1:17:68248980:68315653:1 gene:ENSBTAG00000006569 transcript:ENSBTAT00000008629 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPLFHPPQPGLQGLPTLLCSLTRSLVQYLVKNEPPEGDAGQSDTYLLPSEILGSSSLSKE
NPEESVTTAPLNPVQSGDELREPELEGTVPFAPQDPAAVSTLLPLPEEPGTRHSFPARKK
PPSLKQVNSARKQLRPKATPAAATQRTASQPASPGPVLSIAPGKPRPPGDQDPMASAGEE
TRPLSLSSEEPLWLERKEGAVPTTPAPLQIAPFTSQPLVAHTLPRSPDPGAPAVPEEAPE
APPEDASPVTVMDKGETELTGSASEESQETTTSTIITTTVITTEQAPALCSVSFSDPEGY
IDSSDYPPLPLNNFLECTYNATVYTGYGVELQVKSVNLSEGELLSIRGVDGPSLTVLANH
TLLVEGQVIRSPTNTISVYFRTFQDDGLGTFQLHYQAFMLSCSFPRRPDFGDVTVMDLHS
GGEAHFHCHLGYELQGAKTLTCINASKPHWSSREPICSAPCGGAVHNATIGRVLSPSHSA
NASGSQFCVWTIEAPEGQKLHLHFERLALHKRDRMMVYSGLTNKSTLLYDSFQTENVPFE
GLLSDGHTIRIEFTSNQPPAASAFNIRFEAFEKGHCYEPYIQNGNFTTSDPTYNIGTIVE
FTCDPGHSLEQGPAIIECINVRDPYWNDTEPLCRAMCGGELSAVAGVVLSPNWPEPYVEG
EDCVWKIHVGEEKRIFLDIQFLNLSNSDILTIYDGDEVMPHILGQYLGNSGPQKLYSSTP
DLTIQFHSDPAGLIFGKGQGFIMNYIEVSRNDSCSDLPEIQNGWKTTSHTELVRGARITY
QCDPGYDIVGSDTLTCQWDLSWSSDPPFCEKIMYCTDPGEVDHSTRLISDPVLLVGTTIQ
YTCNPGFVLEGSSLLTCYSRETGTPIWTSRLPHCVSEESLACDNPGLPENGYQILYKRLY
LPGESLTFMCYEGFELMGEVTIRCILGQPSHWNGPLPVCKVNQDSFEHALEVAEAAAETS
LEGGNMALAIFIPVLIISLLLGGAYIYITRCRYYSNLRLPLMYSHPYSQITVETEFDNPI
YETGETREYEVSI
Download sequence
Identical sequences F1MF04
ENSBTAP00000008629 ENSBTAP00000008629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]