SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000008785 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000008785
Domain Number 1 Region: 60-390
Classification Level Classification E-value
Superfamily Subtilisin-like 1.15e-93
Family Subtilases 0.000000000868
Further Details:      
 
Domain Number 2 Region: 389-539
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.78e-43
Family Proprotein convertase P-domain 0.00014
Further Details:      
 
Domain Number 3 Region: 595-759
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.27e-35
Family Growth factor receptor domain 0.00022
Further Details:      
 
Domain Number 4 Region: 734-843
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000152
Family Growth factor receptor domain 0.001
Further Details:      
 
Domain Number 5 Region: 1-43
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.000000000133
Family Prohormone convertase 1 pro-domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000008785   Gene: ENSBTAG00000006675   Transcript: ENSBTAT00000008785
Sequence length 871
Comment pep:known_by_projection chromosome:UMD3.1:21:29553201:29673109:1 gene:ENSBTAG00000006675 transcript:ENSBTAT00000008785 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QIGNLDDYYHFYHSKTFKRSTLSSRGPHTFLRMDPQVKWIQQQEVKRRVKRQVRNDPQAL
YFNDPIWSNMWYMHCGDKNSRCRSEMNVQAAWKRGYTGKNVVVTILDDGIERNHPDLAPN
YDSYASYDVNGNDYDPSPRYDASNENKHGTRCAGEVAASANNSYCIVGVAYNAKIGGIRM
LDGDVTDVVEAKSLGTRPNYIDIYSASWGPDDDGKTVDGPGRLARQAFEHGIRKGRQGLG
SIFVWASGNGGREGDHCSCDGYTNSVYTISVSSTTENGHRPWYLEECASTLATTYSSGAF
YERRIVTTDLRQRCTDGHTGTSVSAPMVAGIIALALEANSQLTWRDVQHLLVKTSRPAHL
KANDWKVNGAGHKVSHLYGFGLVDADALVVEAKKWMAVPPQHTCVAITDKRPRSIPVVQT
LWTTALTTACADHSDQHVGFLEHVVARISISHPRRGDLQIHLTSPSGTRSQLLAKRLLDH
SNEGFTNWEFMTVHCWGEKAEGEWTLEIQDMPSQVRNREKQGKLREWTLILYGTAEHPYT
TFSTHQSRSRMLELSASELEPPRTAVSPSQAEVPEDEEDYTAPSSPGSPSLLQTSVCHPE
CGDKGCDGPGADQCLNCVHFSLGSVKTSRKCVSACPLGYFGDTAARRCRRCHKGCETCSG
RGSTQCLTCRRGFYHHQEVNSCVTLCPAGFYADESQKNCLKCHPSCKKCIDEPEKCTVCK
EGFSLARGSCIPDCEPGTYFDSELIQCGECHHTCRTCVGPSREECIHCAPGFHFQDWRCV
PACGEGFYAEDMPGLPHKVCRRCDESCLSCEGSSRNCSRCKAGFTQLGTSCITNHTCSNA
DETFCEMVKSNRLCERKLFIQFCCRTCLLAG
Download sequence
Identical sequences F1MCT1
9913.ENSBTAP00000008785 ENSBTAP00000008785 ENSBTAP00000008785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]