SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000008833 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000008833
Domain Number 1 Region: 74-583
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 1.53e-194
Family Myeloperoxidase-like 0.00000000000000206
Further Details:      
 
Domain Number 2 Region: 33-71
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000016
Family EGF-type module 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000008833   Gene: ENSBTAG00000006716   Transcript: ENSBTAT00000008833
Sequence length 600
Comment pep:known chromosome:UMD3.1:11:93219287:93245045:1 gene:ENSBTAG00000006716 transcript:ENSBTAT00000008833 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRQGISLRFPLLLLLLSPSPVLPADPGAPAPVNPCCYYPCQHQGICVRFGLDRYQCDCT
RTGYYGPNCTIPEIWTWLRTTLRPSPSFVHFLLTHGRWLWDFVNATFIRDKLMRLVLTVR
SNLIPSPPTYNVAHDYISWESFSNVSYYTRILPSVPRDCPTPMGTKGKKQLPDAEFLSRR
FLLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLER
QYQLRLFKDGKLKYQMLNGEVYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMV
YATIWLREHNRVCDLLKAEHPTWGDEQLFQTARLILIGETIKIVIEEYVQQLSGYFLQLK
FDPELLFGAQFQYRNRIAMEFNQLYHWHPLMPDSFRVGPQDYSYEQFLFNTSMLVDYGVE
ALVDAFSRQPAGRIGGGRNIDHHILHVAVDVIKESRELRLQPFNEYRKRFGMKPYTSFQE
LTGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEMGAPFSLKGLLGNPIC
SPEYWKASTFGGDVGFNLVKTATLKKLVCLNTKTCPYVSFHVPDPHREDRPGVERPPTEL
Download sequence
Identical sequences O62664
ENSBTAP00000008833 NP_001098793.1.59421 NP_001098793.1.76553 ENSBTAP00000008833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]