SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000008880 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000008880
Domain Number 1 Region: 905-974
Classification Level Classification E-value
Superfamily TB module/8-cys domain 7.59e-21
Family TB module/8-cys domain 0.0000687
Further Details:      
 
Domain Number 2 Region: 397-459
Classification Level Classification E-value
Superfamily TB module/8-cys domain 8.37e-18
Family TB module/8-cys domain 0.00047
Further Details:      
 
Domain Number 3 Region: 783-904
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.1e-17
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 4 Region: 569-691
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000014
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 5 Region: 669-783
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000149
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 6 Region: 1079-1131
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000183
Family TB module/8-cys domain 0.0019
Further Details:      
 
Domain Number 7 Region: 270-347
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000445
Family TB module/8-cys domain 0.003
Further Details:      
 
Domain Number 8 Region: 345-392
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000281
Family EGF-type module 0.0034
Further Details:      
 
Domain Number 9 Region: 1168-1209
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000639
Family EGF-type module 0.007
Further Details:      
 
Domain Number 10 Region: 986-1035
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000839
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 1026-1070
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000035
Family EGF-type module 0.006
Further Details:      
 
Domain Number 12 Region: 1195-1245
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000343
Family EGF-type module 0.01
Further Details:      
 
Domain Number 13 Region: 110-139
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000289
Family EGF-type module 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000008880   Gene: ENSBTAG00000006747   Transcript: ENSBTAT00000008880
Sequence length 1250
Comment pep:known_by_projection chromosome:UMD3.1:29:44380356:44400578:-1 gene:ENSBTAG00000006747 transcript:ENSBTAT00000008880 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGPRGAAGGLAPEMRGAGAAGLLALLLLLLLGPGGGAEGGPAGERGAGGGGALARERFK
VVFAPVICKRTCLKGQCRDSCQKGSNMTLIGENGHSTDTLTGSGFRVVVCPLPCMNGGQC
SSRNQCLCPPDFTGRFCQVPAGGAGGGAGGSGPGLGRAGALSTGALPPLAPEGESVASKH
AMYAVQVIADPPGPGEGPPAQHATFLVPLGPGQISAEVQAPPPVVNVRVHHPAEASVQVH
RIEGPNAEGPAPSQHLLPHPKPAHPRPPTQKPLGRCFQDTLPKQPCGSNPLPGLTKQEDC
CGSIGTAWGQSKCHKCPQLQYTGVQKPGPVRGEMGTDCPQGYKRLNSTHCQDINECAMPG
MCRHGDCLNNPGSYRCVCPPGHSLGPSRTQCIADKPEEKSLCFRLVSPEHQCQHPLTTRL
TRQLCCCSVGKAWGARCQRCPADGTAAFKEICPAGKGYHILTSHQTLTIQGESDFSLFLH
PDGPPKPQQLPESPSRAPPPEDTEEERGVSTDSPVIEEQSAQQSHPTVTVSPARPYPELI
SWPPPPQFLPDLPPSRSAVEIAPTQVTETDECRLNQNICGHGECVPGPSDYSCHCNPGYR
SHPQHRYCVDVNECEAEPCGAGRGICMNTGGSYNCHCNRGYRLHVGAGGRSCVDLNECAK
PHLCGDGGFCINFPGHYKCNCYPGYRLKASRPPVCEDIDECRDPSTCPDSKCENKPGSFK
CIACLPGYRSQGGGACRDVNECAEGNPCSPGWCENLPGSFRCTCAQGYAPAQDGRSCLDV
DECEAGDVCDNGICANTPGSFQCQCLSGYHLSRDRSRCEDINECDFPAACIGGDCINTNG
SYRCLCPQGHRLVGGRKCQDIDECSQDPGLCLPHGACENLQGSYVCICDEGFTPTQDQHG
CEEVEQPHHKKECYLNFDDTVFCDSVLATNVTQQECCCSLGAGWGDHCEIYPCPVYSSAE
FHSLCPDGKGYTQDNNIVNYGIPAHRDIDECILFGAEICKEGKCVNTQPGYECYCQHGFY
YDSNLLECVDVDECLDESNCRNGVCENTRGGYRCACTPPAEYSPVQRQCLSPEEMERAPE
RRDVCWGQRGDDGMCAGPLAGPALTFDDCCCRQGRGWGAQCRPCPPRGAGSQCPTSQSES
NSFWDTSPLLLGKPAREEDSSEEDSDECRCVSGRCVPRPGGAVCECPGGFQLDASRARCV
DIDECRELNQRGLLCKTERCVNTSGSYRCVCKAGFARSRTHGACVPQRRR
Download sequence
Identical sequences E1BL59
ENSBTAP00000008880 NP_001179667.1.59421 NP_001179667.1.76553 ENSBTAP00000008880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]