SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000008890 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000008890
Domain Number 1 Region: 44-279
Classification Level Classification E-value
Superfamily Carbonic anhydrase 9.95e-46
Family Carbonic anhydrase 0.0000264
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000008890   Gene: ENSBTAG00000006757   Transcript: ENSBTAT00000008890
Sequence length 307
Comment pep:known_by_projection chromosome:UMD3.1:18:55730210:55736474:-1 gene:ENSBTAG00000006757 transcript:ENSBTAT00000008890 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAAARLSAPRALVLWAALGAAAHIGPAPDPEDWWSYKDNLQGNFVPGPPFWGLVNAAWS
LCAVGKRQSPVDVELKRVLYDPFLPPLRLSTGGEKLRGTLYNTGRHVSFLPAPRPVVNVS
GGPLLYSHRLSELRLLFGARDGAGSEHQINHQGFSAEVQLIHFNQELYGNLSAATRGPNG
LAILSLFVNVAGSSNPFLSRLLNRDTITRISYKSKSLDTGRVRGRGGEVTWILIDRALNI
TSLQMHSLRLLSQNPPSQIFQSLSGNGRPLQPLAHRALRGNRDPRHPERRCRGPNYRLHV
DGAPHGR
Download sequence
Identical sequences E1BL46
ENSBTAP00000008890 ENSBTAP00000008890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]