SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000008955 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000008955
Domain Number 1 Region: 347-646
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.42e-84
Family Protein kinases, catalytic subunit 0.00000000103
Further Details:      
 
Domain Number 2 Region: 57-262
Classification Level Classification E-value
Superfamily Fibronectin type III 1.77e-41
Family Fibronectin type III 0.0000654
Further Details:      
 
Domain Number 3 Region: 641-712
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000000859
Family SAM (sterile alpha motif) domain 0.0014
Further Details:      
 
Domain Number 4 Region: 2-43,91-112
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000283
Family Growth factor receptor domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000008955   Gene: ENSBTAG00000006811   Transcript: ENSBTAT00000008955
Sequence length 716
Comment pep:known_by_projection chromosome:UMD3.1:1:36837036:37123463:1 gene:ENSBTAG00000006811 transcript:ENSBTAT00000008955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCQACQPGFYKASDGNMKCAKCPPHSSTHEDGSVNCRCENNYFRADKDPPSMACTRPPSA
PRNVISNINETSVILDWSWPLDTGGRKDVTFNIICKKCGWNVKQCEPCSPNVRFLPRQFG
LTNTTVTVTDLLAHTNYTFEIDAVNGVSELSSPPRQFAAVSITTNQAAPSPVMTIKKDRT
SRNSISLSWQEPEHPNGIILDYEVKYYEKQEQETSYTILRARGTNVTISSLKPGTTYVFQ
IRARTAAGYGTNSRKFEFETSPDSFSISGENSQVVMIAISAAVAIILLTVVTYVLIGRFC
GYHKSKHGADEKRLHFGNGHLKLPGLRTYVDPHTYEDPTQAVHEFAKELDATNISIDKVV
GAGEFGEVCSGRLKLPSKKEISVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIRLEG
VVTKSKPVMIVTEYMENGSLDSFLRKHDAQFTVIQLVGMLRGIASGMKYLSDMGYVHRDL
AARNILINSNLVCKVSDFGLSRVLEDDPEAAYTTRGGKIPIRWTSPEAIAYRKFTSASDV
WSYGIVLWEVMSYGERPYWEMSNQDVIKAVDEGYRLPPPMDCPAALYQLMLDCWQKDRNN
RPKFEQIVSILDKLIRNPGSLKIITSAAARPSNLLLDQSNIDITTFRTTGDWLNGVRTAQ
CKEIFTGVEYSSCDTIAKISADDMKKVGVTVVGPQKKIISSIKVLETQSKNTPVPV
Download sequence
Identical sequences E1BJS9
ENSBTAP00000008955 ENSBTAP00000008955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]