SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000008967 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000008967
Domain Number 1 Region: 3770-3932
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.31e-31
Family SPRY domain 0.001
Further Details:      
 
Domain Number 2 Region: 3572-3763
Classification Level Classification E-value
Superfamily Fibronectin type III 2.3e-21
Family Fibronectin type III 0.0039
Further Details:      
 
Domain Number 3 Region: 3376-3425
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000275
Family B-box zinc-binding domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000008967   Gene: ENSBTAG00000006823   Transcript: ENSBTAT00000008967
Sequence length 3939
Comment pep:known_by_projection chromosome:UMD3.1:10:10658029:10711354:1 gene:ENSBTAG00000006823 transcript:ENSBTAT00000008967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLSDQDEEGKTEKKCIISDPSFSMVTVQQEDSGITWETSSSRPSTPWASEESQTSGVCSL
EGSTLNSPPGNVSFILDEVKKVRKRKPKSKHGSPSLRRKGNKKRNSFESQDVPANKTSTP
LISESQELTTQKDKSSTGAYDKMRKKKSTSSTPPITGAIYKEYKPLVLRPVYIGTVQYKI
KMFNSVKEELIPLQFYGTLPKGYVIKEIHYRKGKEASISLEPESGNCDLKVVSKTGKSVA
QSIEDVKVKELAPPWRDAFSKGSKSLTSLFSHEDQKKTYDDFPLRAASAAQHTASSHTSH
AIAERESQLSPPRVVPRLLVDEAKPREMKPSFLTPDTSVATFLETAKEESEADSQEIVIA
EPDSSASPPVLDEVKTEDMSSVDHSISLEAEKGSLESGAPGLTASIQEDFSPERDKLDLT
SRERVEPVTDQLTPPHLIIKGGKGETVPEPSISLFEPLVLEEPEKEEIEMPLPMAATPEP
EDSNLVEEEIIELDYPESPSVSEEPFPPRLAPEVEEKEETPLPLLTTSTPEHVTLSEEER
EENESVSTDSAFVSEYSAPQDWNYELEKQEAEPVSLPHVKAVSEHAVLSEEEDDKFEPSS
PTSASIFVSPSTTEKTLECQSPLFSAVTPEPMILSGEEASESGHYTPDSTSASEYLVPSQ
ATEESPKKTVDLKSPLKSQGVSEPLILSEEENEDPGLCSPEVASLSERSVSPHTTEGTSE
GQAPLLSAVTSEHAILSEEENLGNEGVTRDSALTFQNAVPPNVRQESPKNIIDDVSLLKS
EGVSEHKTVLEEEKEDAGFYTPEVASLPEGFLPPSTTEGTPECQVPRLSVAPPDHVVLSE
EETVEMERYTPSSTSASELSEPPYATPESQEEEIVHTSPLNLKGSSSPMIFSEEEQEDIG
PFSPDSAFVSEFSFPPYATTGKREFECDSPICLTSPSEHTILSDEDTEETELFSPDSASQ
ASIPPYRIPEMNKKEIEPDSLLTAMAASGYPRFSEADEEEIAPTTTTPVPEHLSSLQKQR
AEPSVSAPEDLSQLPSTNEAEKAEIKPDAQTTSASVSEYLILAQKQRTQTYLEPEPEDSI
PPSLTSDSERGETKSSSSLAAAPAVKEVPTVKEETKPVLPASQCSVSPDSVHAIKKEQEP
QTSLTPKSADEQMALLKVESKEEIVPDSQEAIAHVLQDQEMEPQPPNVPDSGMKDSVLPD
LADEPKKDVKPNLAPTLTSELEQRRLSEKEPEVTKPYSPLKETSLSRPEISSVVKTEVKL
DSKVTGTPRVLRSASPGVEQEVEHGPPVPEFEFSALSEEIKKEIEPSSSITATSETKHDS
NLTKLAKEEIPKNLPLTTPIEHQVLTKGEKSELGSGLPPVDEHSLFKEDKVAIKASPSPT
ETAASQYPAWSEVEKEIKFDLPASISSISEHSVLSKVETEDIKPGLAITKTLSSQHSDVS
KEARVEDKQDLSFPTVLDSEYLDLSQKKISVSASEMSGPEHVPSLSLGGEIKKTETELPS
SQNMSPAPKYIVPKGKDEVTASSVPELKHLTSEDLASTFLTFSGDKREQAVETPSVIQGD
FRSEKAGLALAQLSLEPEKRDKTHPVSEFPDTGNAGSEFAGDVNRQSGSIQTEHIKSPLP
ETENSALEKGLPELRSRGEGKEENRELHVSTTVPKISEVSSYLREEPQIQEMKSLSAKVV
SLGSREAFTSQLEGDSLEEFQSHTLSSKGLSEELNRSADFKKEEKQEISPLQPAGNLKAQ
ETEDTVTKPNETDQPNSFHVLQSITEPSNITSSDLFVQQKPEEAFVSDQAATLPEISRSF
ADKQDLGIKQVLFMKENLPLEESKLFMTTEPTNVRETHMKEALISPKDENWMLKEPEGDL
VSHHEERAMESVQLDHSGTNDLMTGQLKPALPEKDHMPEIRKQILPPSAEEPHIAFQEPV
STLDTSRDNVETLATETYSSEDIKLAPKPKSLVPAGNVERSEAEGKQTLSFVGGESLVVE
KANTEISRPCKEGSQEEIKTPYEGGLQKPVSGPSVEQVKSETPPSLVKAARALAEEAEPA
LGVEKEAHGRISPLPGEKPLEESNVVQPKVADDANERGKPPSEVKAPTQIKPLSSTQENE
EPQPLESPEVIQKPPKQQKAVEPSISEEKGKKGISSFTSWVSSFFFRSSTLDNEVAEKED
LEAQPSPSEEKTVTVIDSEGPAPADVHGTEKPVSHLFLEAKRETASESAGSLVKSGEHQD
FKEKPALLSDVEVSPQPKSNFEASSDDYGKKEVLDYSGEMDLTSVVTSADGEGHLRIQSD
SPMGEKSIMEEAKNAVPLHVTDSKRLQKPEISPRSKWNISILKEEPRSDQKEKTLFLVDA
TDKVPQQPESGSSSFASKDITEESEKLESIILPGEEPKGSLIDLGEDRLGKEMPKPVSLK
ISEEEVKLRSVSPAEEKGNLGMRSYSLAEKKVLAEKQEIAAPLEHRDINEIEKAKIIHGP
SPVKLEEPKAATVLQQVYQNEDHKERYKIIEEEKGEEKEERSHAFSEGREQEIQPYSISI
AGHPPEESDISFHLTLGETQPFSLVKTTEAAETLETTISEAYSEIRETKAVGSQPHPLEE
REVLVEETKAFLPVDLPYHDEINEPSLPKEGNLVLEKSSRDVVTHSEEKGQVIVSELPKA
GSVGTTEESKQGSPSKESERILDRPFGETKSLETPSYLLSSVKPQTLTSEASPEVSPEKK
QELPWSEVTPHRPTVHTTQTSKDQTSEMFEQPVLVSKHHLEAVEDSQVYEPCPSASSNYA
QFITNASTISADEVVSKEPEDTSVRDEEFTVTSKPAGLSEEQKSAFSIISEGCEILNIHA
PAFISSVDQEESEQMQDKLEYLEEKISFKPILLRDESEEVACHKTLQSKLEDSDIKVISL
KEDQQKEIHTTKEEIPTDSETGDLAFNQPTSPDEEDYFEKYTLIDYNIFPDPEKQSAPWK
LEAGLSKEVPEETVSFPEHSEEGALEHEYDLVKLDESFYGLEKDYSKLSDPETQKSLVIQ
KLTDRDAPKSTDRDVGSKSPGMPLFDEEEGVLSRTQIFPTTAKAINPELLEEPPALAFLY
KDLYEEAVGEKKKEGETASEGDSVNSEASFPSRNSDTDDGTGIYFEKYILKDDILHDTCV
TEKDQGQGLEEKPIDKDDSYQPITAEGEIWGKFATIGREESLEEKQKAAYREGESVGHME
TLDNVAMQRKAPITEEVRVVTQRISYAVPFEDTHHVLERVDETSSQTNEAANANPEVSLN
VPVQVSFPEEEFASGATCMQEILQEEPQIMVPPEPSEDWVRSSPVQDEYEFAESLNYEVV
TQDTLSEDLYSESTPEDVLSQGKESFEHVSENELVTEAEQRKSAEQKELDIEMAEQDQLL
SELVTEKEQKEMKTSQIDTYCYTCKSPISAVDKMLGTHKDHEISTLDTAISAVKVQLADF
LEDLQEKSLRIEAFVSEIESFFNTIEENCSKNEKRLEEQNEEMMKKVLAQYDEKAQSFEE
VKRKKMEFLHDQMVHFLQSMDTAKDTLETIVREAEELDETVFLTSFEEINERLLSAMENT
ASLEKMPAAFSLFEHYDDSSARSDQMLKQVAVPQPPRLEPQEPNSATSTTIAVYWSMNKE
DVIDSFQVYCMEEPQDDQEVNDLVEEYRVTVKESYCVFEDLEPDRCYQVWVMAVNFTGCS
LPSERAIFRTAPSTPVIRAEDCTVCWNTATIRWRPASPEATETYTLEYCRQHAPEGEGLR
SFSGIKGLQLKVNLQPNDNYFFYVRAINAFGTSEQSEAALISTRAIGTRFLLLRETAHPA
LQISSNGTVISFAERRRLTEIPSVLGEELPACGQHYWETTVTDCPAYRLGVCSSSAVQAG
ALAQGETSWYMHCSEPQRYTFFYSGIVSDVHVTERPARVGILLDYTTQRLLFINAETGQM
LFIIRHRFNEGVHPAFALEKPGKCTLHLGIEPPDSARQK
Download sequence
Identical sequences F1ME62
ENSBTAP00000008967 ENSBTAP00000008967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]