SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000008979 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000008979
Domain Number 1 Region: 60-277
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.71e-67
Family Lectin leg-like 0.0000000179
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000008979   Gene: ENSBTAG00000006833   Transcript: ENSBTAT00000008979
Sequence length 518
Comment pep:known chromosome:UMD3.1:24:58797010:58815897:-1 gene:ENSBTAG00000006833 transcript:ENSBTAT00000008979 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGSRRRGPRAAMRPLLCALLLCVCRSAGGDGPGGSPGAASATEVSRSVPGRIRESKSPL
HHPQIKRQYGYVPAWMHTAEAIPSSDQIRIAPSLKSQRGSVWTKTKAAFENWELEVTFRV
TGRSRIGADGLAVWYTENQGLEGPVFGSADMWNGVGIFFDSFDNDGKKNNPAIVIIGNNG
QIHYDHQNDGANQALSSCQRDFRNKPYPVRAKITYYQKTLTVMINNGFTPDKNDYEFCAK
VENMIIPAQGHFGISAATGGLADDHDVLSFLTFQLTEPGKEPPTVDKEISEKEKEKYQEE
FEHFQQELDKKKEEFQKDHPDLQGHPTDEMFESVGDRELRQVFEGQNRIHLEIKQLNRQL
DMILDEQRRYVSSLTEEISKRGAGAPGQQGQTFQQELDTVVNTQHEILRQVNELKNSMSE
TVRLVSGIAHPGPAAGVYETTQHFNDIKEHLHIVKRDIDSLAQRSMPSNERPKCPELPPF
PSCLSTVHFVIFVVVQTVLFIGYIMYRTQQEAAAKKFF
Download sequence
Identical sequences F1ME46
ENSBTAP00000008979 ENSBTAP00000008979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]