SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000009005 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000009005
Domain Number 1 Region: 10-154
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.45e-50
Family Galectin (animal S-lectin) 0.00016
Further Details:      
 
Domain Number 2 Region: 192-322
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.06e-45
Family Galectin (animal S-lectin) 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000009005   Gene: ENSBTAG00000006846   Transcript: ENSBTAT00000009005
Sequence length 323
Comment pep:known chromosome:UMD3.1:19:19738612:19757359:1 gene:ENSBTAG00000006846 transcript:ENSBTAT00000009005 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFGGAQASYINPVVPFTGMIQGGLQDGHKITIIGAVLPSGGNRFAVNLQTGYNDSDIAF
HFNPRFEEGGYVVCNTKQRGSWGTEERKMHMPFQRGCSFELCFQVQSSEFRVMVNGNLFT
QYAHRVPFHRIDAISITGVVQLSSISFQPPGIWPANSAPIAQTFVHTIHSAPGQMFPNPV
IPPAVYPNPVYQLPFFTSILGGLYPSKSILVSGTILPSAQRFYINLRSGSDIAFHLNPRF
NENAVVRNTQINGSWGSEERSLPRGMPFFRGQSFSVWIMCEGHCFKVAVDSQHLFEYHHR
LKNLPAINNLEVGGDIQLTHVQT
Download sequence
Identical sequences A0A1Y1C5S8 Q5E9E0
NP_001015570.1.59421 NP_001015570.1.76553 XP_005896746.1.15283 XP_010859748.1.44457 XP_019837619.1.53367 ENSBTAP00000009005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]