SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000009011 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000009011
Domain Number 1 Region: 45-214
Classification Level Classification E-value
Superfamily vWA-like 1.13e-45
Family Integrin A (or I) domain 0.00072
Further Details:      
 
Domain Number 2 Region: 525-709
Classification Level Classification E-value
Superfamily vWA-like 4.9e-42
Family Integrin A (or I) domain 0.0013
Further Details:      
 
Domain Number 3 Region: 298-519
Classification Level Classification E-value
Superfamily vWA-like 5.56e-30
Family Integrin A (or I) domain 0.005
Further Details:      
 
Domain Number 4 Region: 713-751
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000026
Family EGF-type module 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000009011   Gene: ENSBTAG00000006860   Transcript: ENSBTAT00000009011
Sequence length 788
Comment pep:known_by_projection chromosome:UMD3.1:26:35006215:35047805:1 gene:ENSBTAG00000006860 transcript:ENSBTAT00000009011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSFLLLEAICIVLFAGVPPSLPLQEVHVSKEIIGKISVASKMMWCSAAVDVLFLMDGSH
SVGKGSFERSKHFAITVCDALDINPRKVRVGAVQFSSVPRLEFPLDAFSTQQGVKGKIKR
MVFKGGHTETSLALKYLLRKGFPGGRNASVPQVLIIITDGRSQGHVALPAKQLKQRGITV
FSVGIHFPRWEELHSLASEPREQHVLMAEEVDDATNGLFSTLSGSSICTTASPDCKVHPH
PCERKTLETIRELAGLAPCWRGSRGTDAVLAALCPFSSWKRVFFTHPTTCYRTTCPGPCD
SQPCQNGGTCVPEGPDRYHCLCPPAFGGEANCALNLSLECRVDVLFLLASSADATLEGFQ
RAKAFVKRFVRAALTRDSQARVGVALYGAKLTVAVPVGEYQDVPDLIWSLDGLPFDGGAT
LTGRALRQVAERGFGSAPRTGLDQPRRAVVLMTEARSQDEVAGPAGFARARQLLLLGVGS
EDVRAELEMITGGPERVLTYTSPQDLFDQIPKLQGKLCSRPRPGCQAQSLDLVFMLDASV
SVGPENFAQMQSFVRSCVLRFDVNPDVTQIGLVVYGSRVQTAFGLDTHLSRAAVLRALSQ
APYLGGVGSAGTALLHIYDKVMTVQGGARPGVPKAVVVVTGGSGVEDAAVPAQKLRDNGV
SVLVVGVGPVLREALWRLAGPRDALIHAAAYADLSHHQDALIEWICREAKRPVNLCKPSP
CMNEGICVLRNGSYRCECQGGWEGPHCENRALRGDALKARGSSREPAGGQPPRPSRLGLQ
RRPGPPGR
Download sequence
Identical sequences E1BH09
ENSBTAP00000009011 ENSBTAP00000009011 XP_015316232.1.76553 XP_015325101.1.59421 9913.ENSBTAP00000009011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]