SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000009025 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000009025
Domain Number 1 Region: 10-154
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.74e-50
Family Galectin (animal S-lectin) 0.00016
Further Details:      
 
Domain Number 2 Region: 224-354
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.31e-45
Family Galectin (animal S-lectin) 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000009025   Gene: ENSBTAG00000006846   Transcript: ENSBTAT00000009025
Sequence length 355
Comment pep:known chromosome:UMD3.1:19:19738612:19757359:1 gene:ENSBTAG00000006846 transcript:ENSBTAT00000009025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFGGAQASYINPVVPFTGMIQGGLQDGHKITIIGAVLPSGGNRFAVNLQTGYNDSDIAF
HFNPRFEEGGYVVCNTKQRGSWGTEERKMHMPFQRGCSFELCFQVQSSEFRVMVNGNLFT
QYAHRVPFHRIDAISITGVVQLSSISFQNIRAAPKQPACSKVQFSQAVCLPPRPRGRKSN
PPGIWPANSAPIAQTFVHTIHSAPGQMFPNPVIPPAVYPNPVYQLPFFTSILGGLYPSKS
ILVSGTILPSAQRFYINLRSGSDIAFHLNPRFNENAVVRNTQINGSWGSEERSLPRGMPF
FRGQSFSVWIMCEGHCFKVAVDSQHLFEYHHRLKNLPAINNLEVGGDIQLTHVQT
Download sequence
Identical sequences F1MZ12 L8IJN8
ENSBTAP00000009025 NP_001034266.1.59421 NP_001034266.1.76553 XP_005896745.1.15283 XP_010859747.1.44457 XP_019837618.1.53367 9913.ENSBTAP00000009025 ENSBTAP00000009025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]