SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000009152 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000009152
Domain Number 1 Region: 1-86
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 1.39e-33
Family Ribosomal L11/L12e N-terminal domain 0.00000649
Further Details:      
 
Domain Number 2 Region: 75-148
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 1.32e-18
Family Ribosomal protein L11, C-terminal domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000009152   Gene: ENSBTAG00000006963   Transcript: ENSBTAT00000009152
Sequence length 165
Comment pep:known chromosome:UMD3.1:11:98191880:98195943:-1 gene:ENSBTAG00000006963 transcript:ENSBTAT00000009152 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPKFDPNEIKVVYLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKATGDWKGLRITV
KLTIQNRQAQIEVVPSASALIIKALKEPPRDRKKQKNIKHSGNITFDEIVNIARQMRHRS
LARELSGTIKEILGTAQSVGCNVDGRHPHDIIDDINSGAVECPAS
Download sequence
Identical sequences A0A0B8RZ72 A0A1S3WIH2 A0A250YAS6 A0A287AP66 A0A2J8UKB0 A0A2K6V858 E2RR58 G3QEE4 H2QZG4 P30050 P61284
ENSCAFP00000035849 HR3175 ENSBTAP00000009152 ENSBTAP00000009155 ENSPTRP00000038960 ENSPTRP00000060399 3j92_t 4v5z_Bi 4v6x_CK 5a8l_G 5aj0_Aq 5lzs_t 5lzt_t 5lzu_t 5lzv_t 5lzw_t 5lzx_t 5lzy_t 5lzz_t 6hcf_t3 6hcj_u3 6hcm_t3 6hcq_u3 gi|4506597|ref|NP_000967.1| 9598.ENSPTRP00000038960 9600.ENSPPYP00000021988 9606.ENSP00000354739 9615.ENSCAFP00000029847 9685.ENSFCAP00000009564 9913.ENSBTAP00000009152 9913.ENSBTAP00000009155 ENSP00000354739 ENSPTRP00000038960 ENSPTRP00000060399 NP_000967.1.87134 NP_000967.1.92137 NP_001238858.1.37143 NP_001238885.1.84170 NP_991366.1.59421 NP_991366.1.76553 WP_071211971.1.25524 WP_071211971.1.33541 WP_071211971.1.92515 XP_002720524.1.1745 XP_002748725.1.60252 XP_002754418.1.60252 XP_002821293.1.23681 XP_003822339.1.60992 XP_003940660.1.74449 XP_003995947.1.62641 XP_004048680.1.27298 XP_004593613.1.84141 XP_004757328.1.14098 XP_005346086.1.66349 XP_005660499.1.46622 XP_005687214.2.57651 XP_005901920.1.15283 XP_005980527.1.78601 XP_005982679.1.78601 XP_006737204.1.47382 XP_009444016.1.37143 XP_009453100.1.37143 XP_010855221.1.44457 XP_011964111.1.54773 XP_012045749.1.66739 XP_012313535.1.9421 XP_016046183.1.11023 XP_016066484.1.3490 XP_017404585.1.71028 XP_018879351.1.27298 XP_019276621.1.44245 XP_019826446.1.53367 XP_020029381.1.5219 XP_020730572.1.74333 XP_021049043.1.100879 XP_021502247.1.76796 XP_021502248.1.76796 XP_021547402.1.83697 ENSP00000354739 ENSFCAP00000009564 ENSBTAP00000009152 ENSBTAP00000009155 ENSP00000354739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]