SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000009228 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000009228
Domain Number 1 Region: 216-393
Classification Level Classification E-value
Superfamily MIR domain 3.79e-46
Family MIR domain 0.0024
Further Details:      
 
Domain Number 2 Region: 1081-1207
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.62e-19
Family SPRY domain 0.043
Further Details:      
 
Domain Number 3 Region: 661-795
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000127
Family SPRY domain 0.046
Further Details:      
 
Domain Number 4 Region: 4058-4136
Classification Level Classification E-value
Superfamily EF-hand 0.00000578
Family Calmodulin-like 0.047
Further Details:      
 
Domain Number 5 Region: 1433-1557
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000107
Family SPRY domain 0.033
Further Details:      
 
Domain Number 6 Region: 442-551
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000109
Family IP3 receptor type 1 binding core, domain 2 0.012
Further Details:      
 
Domain Number 7 Region: 2198-2268
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000126
Family IP3 receptor type 1 binding core, domain 2 0.018
Further Details:      
 
Domain Number 8 Region: 102-186
Classification Level Classification E-value
Superfamily MIR domain 0.0000392
Family MIR domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000009228   Gene: ENSBTAG00000006999   Transcript: ENSBTAT00000009228
Sequence length 5042
Comment pep:known_by_projection chromosome:UMD3.1:18:48502352:48631056:1 gene:ENSBTAG00000006999 transcript:ENSBTAT00000009228 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDGGEGEDEVQFLRTDDEVVLQCNATVLKEQLKLCLAAEGFGNRLCFLEPTSNAQNVPP
DLAICCFVLEQSLSVRALQEMLANTVEAGVESSQGGGHRTLLYGHAILLRHAHSGMYLSC
LTTSRSMTDKLAFDVGLQEDAIGEACWWTTHPASKQRSEGEKVRVGDDLILVSVSSERYL
HLSTASGELQVDASFMQTLWNMNPICSGCEEGYVTGGHVLRLFHGHMDECLTISPADSDD
QRRLVYYEGGSVCTHARSLWRLEPLRISWSGSHLRWGQPLRIRHVTTGRYLALVEDQGLM
VVDASKAHTKATSFCFRVSKEKLDTAPKRDVEGMGPPEIKYGESLCFVQHVASGLWLTYA
APDPKALRLGVLKKKAILHQEGHMDDALSLTRCQHEESQAARMIYSTAGLYNHFIKGLDS
FSGKPRGSGSPAGTALPLEGVILSLQDLIGYFEPPSEELQHEEKQSKLRSLRNRQSLFQE
EGMLSLVLNCIDRLNVYTTAAHFAEFAGEEAAESWKEIVNLLYEILASLIRGNRANCALF
SNNLDWLVSKLDRLEASSGILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGRNHKVL
DVLCSLCVCNGVAVRSNQDLITENLLPGRELLLQTNLINYVTSIRPNIFVGRAEGTTQYL
KWYFEVMVDEVVPFLTAQATHLRVGWALTEGYSPYPGGGEGWGGNGVGDDLYSYGFDGLH
LWTGHVPRLVTYPGQHLLAPEDVVSCCLDLSVPSISFRINGCPVQGVFEAFNLDGLFFPV
VSFSAGVKVRFLLGGRHGEFKFLPPPGYAPCHEAVLPRERLHLEPIKEYRREGPRGPHLV
GPSRCLSHTDFVPCPVDTVQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGPVRDDN
KRLHPCLVDFHSLPEPERNYNLQMSGETLKTLLALGCHVGMADEKAEDNLKKTKLPKTYM
MSNGYKPAPLDLSHVRLTPAQTTLVDRLAENGHNVWARDRVAQGWSYSAVQDIPARRNPR
LVPYRLLDEATKRSNRDSLCQAVRTLLGYGYNIEPPDQEPSQVESQSRWDRVRIFRAEKS
YVVQSGRWYFEFEAVTTGEMRVGWARPELRPDVELGADDLSYVFNGHRGQRWHLGSEPFG
RPWQSGDVVGCMIDLTENTIIFTLNGEVLMSDSGSETAFRDIEIGDGFLPVCSLGPGQVG
HLNLGQDVSSLRFFAICGLQEGFEPFAINMQRPVTTWFSKGLPQFEAVPPEHPHYEVTRV
DGTVDTPPCLRLTHRTWGSQNSLVEMLFLRLSLPVQFHQHFRCTAGATPLAPPGLQPPAE
DEARAAEPDPDYENLRRSAGHWAEAEGNKEGTAKEGTPGSPAQAGVEAQPARAENEKDAT
TEKNKKRGFLFKAKKAAMMTQPPATPTLPRLPHEVVPADDRDDPEIILNTTTYYYSVRVF
AGQEPSCVWVGWVTPDYHQHDMNFDLSKVRAVTVTMGDEQGNIHSSLKCSNCYMVWGGDF
VSPGQQGRISHTDLVIGCLVDLATGLMTFTANGKESNTFFQVEPNTKLFPAVFVLPTHQN
VIQFELGKQKNIMPLSAAMFLSERKNPTPQCPPRLEMQMLMPVSWSRMPNHFLQVETRRA
GERLGWAVQCQEPLTMMALHVPEENRCMDILELSERLDLQRFHSHTLRLYRAVCALGNNR
VAHALCSHVDQAQLLHALEDAHLPGPLRAGYYDLLISIHLESACRSRRSMLSEYIVPLTP
ETRAITLFPPGKRADNGPRRYGLPGVGVTTSLRPPHHFSAPCFVAALPAAGAAEAPARLS
PSIPLEALRDKALRMLGEAVRDGGQHARDPVGGSVEFQFVPVLKLVSTLLVMGIFGDEDV
KQILKMIEPEVFTEEEEEEEEEEEGEEEEEDEEEKEEDEEEEAREKEDEEKEEEETAEGE
KEDLEEGLLQMKLPESVKLQMCNLLEYFCDQELQHRVESLAAFAERYVDKLQANQRDRYA
ILIKAFTMTAAETARRTREFRSPPQEQINMLLHFKTAEDEEDCPLPEEVRQDLLEFHRDL
LTHCGIQLEGEEEEPEEEATLGSRLMSLLEKVRLVKKKEEKSEEEPPAEERKPQSLQELV
SHTVVRWAQEDFVQSPELVRAMFSLLHRQYDGLGELLRALPRAYTISPSSVEDTMSLLEC
LGQIRSLLIVQMGPQEENLMIQSIGNIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGG
ESKEIRFPKMVTSCCRFLCYFCRISRQNQRSMFDHLSYLLENSGIGLGMQGSTPLDVAAA
SVIDNNELALALQEQDLEKVVSYLAGCGLQSCPMLLAKGYPDIGWNPCGGERYLDFLRFA
VFVNGESVEENANVVVRLLIRKPECFGPALRGEGGSGLLATIEEAIRISEDPARDGPGVR
RDRRREHFGEEPPEENRVHLGHAIMSFYAALIDLLGRCAPEMHLIQAGKGEALRIRAILR
SLVPLDDLVGIISLPLQIPTLGKDGALVQPKMSASFVPDHKASMVLFLDRVYGIENQDFL
LHVLDVGFLPDMRAAASLDTATFSTTEMALALNRYLCLAVLPLITKCAPLFAGTEHRAIM
VDSMLHTVYRLSRGRSLTKAQRDVIEECLMALCRYIRPSMLQHLLRRLVFDVPILNEFAK
MPLKLLTNHYERCWKYYCLPTGWANFGVTSEEELHLTRKLFWGIFDSLAHKKYDQELYRM
AMPCLCAIAGALPPDYVDASYSSKAEKKATVDAEGNFDPRPVETLNVIIPEKLDSFINKF
AEYTHEKWAFDKIQNNWSYGENIDEELKTHPMLRPYKTFSEKDKEIYRWPIKESLKAMIA
WEWTIEKAREGEEEKTEKKKTRKISQSAQTYDAREGYNPQPPDLSGVTLSRELQAMAEQL
AENYHNTWGRKKKQELEAKGGGTHPLLVPYDTLTAKEKARDREKAQELLKFLQMNGYAVT
RGLKDMELDTSSIEKRFAFGFLQQLLRWMDISQEFIAHLAEAVVSSGRVEKSPHEQEIKF
FAKILLPLINQYFTNHCLYFLSTPAKVLGSGGHASNKEKEMITSLFCKLAALVRHRVSLF
GTDAPAVVNCLHILARSLDARTVMKSGPEIVKAGLRSFFESASEDIEKMVENLRLGKVSQ
ARTQVKGVGQNLTYTTVALLPVLTTLFQHIAQHQFGDDVILDDVQVSCYRTLCSIYSLGT
TRNPYVEKLRPALGECLARLAAAMPVAFLEPQLNEYNACSVYTTKSPRERAILGLPNSVE
EMCPDIPVLERLMADIGGLAESGARYTEMPHVIEITLPMLCSYLPRWWERGPEAPPPALP
AGAPPPCTAVTSDHLNSLLGNILRIIVNNLGIDEATWMKRLAVFAQPIVSRARPELLHSH
FIPTIGRLRKRAGKVVAEEEQLRLEAKAEAEEGELLVRDEFSVLCRDLYALYPLLIRYVD
NNRAHWLTEPNPSAEELFRMVGEIFIYWSKSHNFKREEQNFVVQNEINNMSFLTADNKSK
MAKQTGDVQSGGSDQERTKKKRRGDRYSVQTSLIVATLKKMLPIGLNMCAPTDQELITLA
KTRYALKDTDEEVREYLQNNLHLQGKVEGSPSLRWQMALYRGLPGREEDADDPEKIVRRV
QEVSAVLYHLEQIEHPYKSKKAVWHKLLSKQRRRAVVACFRMTPLYNLPTHRACNMFLES
YKAAWILTEDHSFEDRMIDDLSKAGEQEEEEEEVEEKKPDPLHQLVLHFSRTALTEKSKL
DEDYLYIAYADIMAKSCHLEEGGENGEAEEEEVEVSFEEKEMEKQRLLYQQARLHTRGAA
EMVLQMISACKGETGAMVSSTLKLGISILNGGNADVQQKMLDYLKDKKEVGFFQSIQALM
QTCSVLDLNAFERQNKAEGLGMVNEDGTVINRQNGEKVMADDEFTQDLFRFLQLLCEGHN
NDFQNYLRTQTGNTTTINIIICTVDYLLRLQESISDFYWYYSGKDVIEEQGKRNFSKAMS
VAKQVFNSLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMMMKLAQDSSQIELLKEL
LDLQKDMVVMLLSLLEGNVVNGMIARQMVDMLVESSSNVEMILKFFDMFLKLKDIVGSEA
FQDYVTDPRGLISKKDFKKAMDSQKQFTGPEIQFLLSCSEADENEMINCEEFANRFQEPA
RDIGFNVAVLLTNLSEHVPHDPRLRNFLELAESILEYFRPYLGRIEIMGASRRIERIYFE
ISETNRAQWEMPQVKESKRQFIFDVVNEGGESEKMELFVSFCEDTIFEMQIAAQISEPEG
EPEEDEDEGVGAAEAGAESAEEGAAGPEGAAATAAAGATARLVAAANRAMRGLSYRSLRR
RVRRLRRLTAREAATAVAALLWAVLAQGGAAGAGAAAGALRLLWGSLFGGGLVEGAKKVT
VTELLAGMPDPTSDEVHGEQPAGSGGDADGEGAGEGAGDAAEGAGDEEVADQEDPGVADG
TVAVADGGPFRPEGAGLGDMGDTTPAEPPTPEGSPIIKRKLGVDGEEEELPPEPEPEPEP
EPEKADAENGEKEEVPETPPEPPKKAAPPPPPPKKEGAGGAGLEFWGELEVQRVKFLNYL
SRNFYTLRFLALFLAFAINFILLFYKVSDSPPGEDDMEGSAAGGLSGAGSGGGSGWGSGA
GEEAEGDEDENMVYYFLEESTGYMEPALRCLSLLHTLVAFLCIIGYNCLKVPLVIFKREK
ELARKLEFDGLYITEQPEDDDVKGQWDRLVLNTPSFPSNYWDKFVKRKVLDKHGDIYGRE
RIAELLGMDLATLEITAHNERKPEPPPGLLTWLMSIDVKYQIWKFGVIFTDNSFLYLGWY
MVMSLLGHYNNFFFAAHLLDIAMGVKTLRTILSSVTHNGKQLVMTVGLLAVVVYLYTVVA
FNFFRKFYNKSEDEDEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDEYELYRVV
FDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGSDYFDTTPHGF
ETHTLEEHNLANYMFFLMYLINKDETEHTGQESYVWKMYQERCWDFFPAGDCFRKQYEDQ
LS
Download sequence
Identical sequences E1BDQ4
ENSBTAP00000009228 ENSBTAP00000009228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]