SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000009238 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000009238
Domain Number 1 Region: 40-259
Classification Level Classification E-value
Superfamily L domain-like 5.35e-35
Family Ngr ectodomain-like 0.0045
Further Details:      
 
Domain Number 2 Region: 250-345
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000876
Family I set domains 0.0099
Further Details:      
 
Domain Number 3 Region: 451-518
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000116
Family Fibronectin type III 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000009238   Gene: ENSBTAG00000007019   Transcript: ENSBTAT00000009238
Sequence length 641
Comment pep:known_by_projection chromosome:UMD3.1:6:16702358:16719812:-1 gene:ENSBTAG00000007019 transcript:ENSBTAT00000009238 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMHLFASLCIALSLLERVSCLCPSQCTCDYHGRNDGLGSSRAVLCNDLDMNEVPTNFPVD
TVKLRIERTVVRRIPAEAFYYLVELQYLWLTYNSVASLDVSSFYNLKHLHELRLDGNSLT
AFPWTSLRDMPRLRTLDLHNNRITSVPKEAVRYLKNLTYLDLSSNRLTTLPPDFLESWSH
LVTASSRSLDLPPRRIILGLQDNPWFCDCHISKIMSLSKVADPAIVLLDPMMVCSEPERL
TGILFQRAELEQCVKPSVMTSATQITSALGSNVLLRCDATGYPTPQLTWTRPDNSPVNYT
VIQESPGEGVRWSIISLTGISYMDAGDYKCKAKNLAGMSEAVVTVSSSSSPWPYSSSSST
FPPTSTSSPPSTASFSLSPFFSSTVSSATTPSTRISSSTTMANRQSLSPDGKRSAKAEMG
GGKLPPASASRREELALLDRALRMEANATIENLQVVSETEESVILTWDTINTTQNSEVTV
FYSKYGEKDLLLLNVNSSKNQVTINGLLPGWQYIACVCPKGMPPQKDQCVTFSTDRAAEG
DSQEFFLMVLSGAACVAVLPLIFFLLYKVCKLQCKPDSLWEDDLAKETYIQFETLSPRSQ
SVGELWTRRPRAESEKLPLCSRSSVESPTTKSEGSGSEYYC
Download sequence
Identical sequences F1MY47
ENSBTAP00000009238 ENSBTAP00000009238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]