SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000009285 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000009285
Domain Number 1 Region: 184-265
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.01e-25
Family Thyroglobulin type-1 domain 0.00013
Further Details:      
 
Domain Number 2 Region: 23-105
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.79e-24
Family Growth factor receptor domain 0.0000532
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000009285   Gene: ENSBTAG00000007062   Transcript: ENSBTAT00000009285
Sequence length 271
Comment pep:known chromosome:UMD3.1:2:105378991:105397646:-1 gene:ENSBTAG00000007062 transcript:ENSBTAT00000009285 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLTAVLLLLAACAGSAQGLGSFVHCEPCDEKALSMCPPSPLGCELVKEPGCGCCMTCAL
AEGQSCGVYTERCAQGLRCLPRQDEEKPLHALLHGRGVCLNEKSYREQAKIERDSREHEE
PTTSEMAEETYSPKIFRPKHTRISELKAEAVKKDRRKKLTQSKFVGGAENTAHPRVISAP
EMRQKSEQGPCRRHMEASLQELKASPRMVPRAVYLPNCDRKGFYKRKQCKPSRGRKRGIC
WCVDKYGMKLPGMEYVDGDFQCHTFDSSNVE
Download sequence
Identical sequences Q05717
ENSBTAP00000009285 NP_001098797.1.59421 NP_001098797.1.76553 ENSBTAP00000009285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]