SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000009351 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000009351
Domain Number 1 Region: 25-162
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.64e-41
Family Galectin (animal S-lectin) 0.00018
Further Details:      
 
Domain Number 2 Region: 189-316
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.31e-17
Family Galectin (animal S-lectin) 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000009351   Gene: ENSBTAG00000007108   Transcript: ENSBTAT00000009351
Sequence length 316
Comment pep:known_by_projection chromosome:UMD3.1:29:42397683:42406764:1 gene:ENSBTAG00000007108 transcript:ENSBTAT00000009351 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TPMAPGEKLDPLPDTFILQPPVFQPVIPFVTTIFGGLRAGKMVMLQGAVPLNAHRFQVDF
QCGCSLHPRPDIAIHFNPRFHTTKPHVICNSLYRGRWQVEARWPHVALQRGASFLILFLF
GNEEMKVSVNGQHFLHYRYRLPLSRVDTLGIFGDISVTAVGFLNINPFVEGGSEYPVGHP
FLLRSPGLEVPCFHALPRGLWPGQVIIVRGLVLPEPKDFTLSLRDEAAHVPVTLRASFAD
RTLAWVSRWGRKKLILAPFLFYPQRFFEVLLLCQEGGLKLALNGQGVGATSLGQQVLEQL
RELRISGSVQLYCVHY
Download sequence
Identical sequences F1MYQ2
ENSBTAP00000009351 ENSBTAP00000009351 9913.ENSBTAP00000009351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]