SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000009501 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000009501
Domain Number 1 Region: 111-297
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.87e-75
Family F-box associated region, FBA 0.0000000182
Further Details:      
 
Domain Number 2 Region: 44-141
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000000183
Family F-box domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000009501   Gene: ENSBTAG00000007223   Transcript: ENSBTAT00000009501
Sequence length 297
Comment pep:known chromosome:UMD3.1:16:42906700:42912737:1 gene:ENSBTAG00000007223 transcript:ENSBTAT00000009501 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGDGDPESVGQPEEASPEEQQEEACAEEANGGEERPEDDGEGEAAYLDELPEPLLLRVL
AELPAAQLVQACRLVCLRWKELVDGAPLWLLKCQQEGLVPQDGPEDERDHWQQFYFLSKR
RRNLLRNPCGEEDLEGWCDVEHGGDGWRVEELPGDCGVEFIHDESVKKYFASSFEWCRKA
QIIDLQAEGYWEELLDTTQPAIVVKDWYSGRRDAGCLYELTVKLLSEHEDVLAEFNSGQV
AVPADSDDGGWTEISHTFTDYGPGVRFIRFEHGGQDCVYWKGWFGARVTNSSVWVEP
Download sequence
Identical sequences Q17QK6
ENSBTAP00000009501 NP_001069037.1.59421 NP_001069037.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]