SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000009504 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000009504
Domain Number 1 Region: 68-251
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.28e-75
Family F-box associated region, FBA 0.00000174
Further Details:      
 
Domain Number 2 Region: 4-83
Classification Level Classification E-value
Superfamily F-box domain 1.7e-16
Family F-box domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000009504   Gene: ENSBTAG00000032617   Transcript: ENSBTAT00000009504
Sequence length 255
Comment pep:known chromosome:UMD3.1:16:42901488:42905541:-1 gene:ENSBTAG00000032617 transcript:ENSBTAT00000009504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVGNINELPENILLELFTHVPARQLLLRCRLVCSLWRDLIDLVTLWKRKCLREGFITED
WDQPVADWKVFYFLRSLRRNLLHNPCAEEGFEFWSLDVNGGDEWKVEDLSKDQRKEFPND
QVKKYFVTSYYTCLKSQVVDLKAEGYWEELMDTTRPDIEVKDWFAARPDCGSKYQLCVQL
LSSAHAPLGTFQPDPAMIQQKSDAKWREVSHTFSNYPPGVRYIWFQHGGVDTHYWAGWYG
PRVTNSSITIGPPLP
Download sequence
Identical sequences A7MBH8
ENSBTAP00000009504 ENSBTAP00000009504 9913.ENSBTAP00000009504 NP_001094765.1.59421 NP_001094765.1.76553 XP_005217044.1.76553 XP_005901370.1.15283 XP_020748964.1.74333 XP_020749036.1.74333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]