SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000009516 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000009516
Domain Number 1 Region: 287-331
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000544
Family EGF-type module 0.094
Further Details:      
 
Domain Number 2 Region: 354-412
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000698
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 3 Region: 410-457
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000012
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 4 Region: 457-491
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000302
Family EGF-type module 0.023
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000009516
Domain Number - Region: 25-43,93-171
Classification Level Classification E-value
Superfamily Sialidases 0.000206
Family Endo-alpha-sialidase 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000009516   Gene: ENSBTAG00000007235   Transcript: ENSBTAT00000009516
Sequence length 531
Comment pep:known chromosome:UMD3.1:11:102286504:102356914:1 gene:ENSBTAG00000007235 transcript:ENSBTAT00000009516 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRLLALLLHCLALASGDYDICKSWVTTDEGPTWEFYACQPKVMRLKDYVKVKVEPSGIT
CGDPPERFCSHENPYLCSNECDASNPDLAHPPRLMFDREDEGLATYWQSVTWSRYPSPLE
ANITLSWNKSVELTDDVVVTFEYGRPTVMVLEKSLDNGRTWQPYQFYAEDCMEAFGMPAR
RARDLSASGAHRVLCTEEYSRWAGSKKEKHVRFEVRDRFAIFAGPDLRNMDNLYTRLESA
KGLKEFFTLTDLRMRLLRPALGGTYVQRENLYKYFYAISNIEVTGRCKCNLHANLCSVRE
GSLQCECEHNTTGPDCGKCKRSFRTRSWRAGSYLPLPHGSPNACAAAGSAVGNCECYGHS
NRCSYIDFLNVVTCVSCKHNTRGQHCQHCRLGYYRNGSAELDDENVCIECNCNQIGSVHD
RCNETGFCECREGAAGPKCDDCLPTHYWRQGCYPNVCDDDQLLCQNGGTCVQNQRCACPR
GYTGARCEQPRCDPADDEGGLDCDRAPGAAPRPATLLGCLLLLGLAARLDC
Download sequence
Identical sequences A5PKI5
NP_001092495.1.59421 NP_001092495.1.76553 XP_005213332.1.76553 XP_006052203.1.26621 ENSBTAP00000009516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]