SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000009531 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000009531
Domain Number 1 Region: 421-652
Classification Level Classification E-value
Superfamily GFP-like 1.36e-92
Family Domain G2 of nidogen-1 0.00000000195
Further Details:      
 
Domain Number 2 Region: 932-1172
Classification Level Classification E-value
Superfamily YWTD domain 6.02e-46
Family YWTD domain 0.000000000949
Further Details:      
 
Domain Number 3 Region: 803-908
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.83e-25
Family Thyroglobulin type-1 domain 0.0004
Further Details:      
 
Domain Number 4 Region: 378-418,663-750
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.55e-16
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 5 Region: 754-833,866-879,1189-1233
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000424
Family Growth factor receptor domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000009531   Gene: ENSBTAG00000007244   Transcript: ENSBTAT00000009531
Sequence length 1236
Comment pep:known_by_projection chromosome:UMD3.1:28:8733209:8829937:-1 gene:ENSBTAG00000007244 transcript:ENSBTAT00000009531 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLATVRRSGAAWTRALLLQLLLAGPGGCLSRQELFPFGPEHGDLELEAGDDLVSPALELS
TALHFFDRSDIDSVYVTTNGIIAMSEPPAKETHPGPFPPTFGAVAPFLADLDTTDGLGKV
YYREDLSPSVTQLAAECVQRGFPEVSFKPSSAVVVTWESVAPYQGPSKDPTLEGKVSTPK
IPEITSHMARTELINYSPSCSYFGRWFLDREFITNPAVRAESRFFEGLMITSYSVHQFFA
SGGQSIGASALASNSMDRGAWQATAHGVAEADVVLSGPHRAETTQQDMVEMYPVGTTLAK
TSSQPFQRHAQGYFQTLKCPHTLTSRKGQPPQEPGSPPSLRTSMYSFPGKRYSQEQVSVF
LMDSVAEGEAVFRYNTDSRQTCANNRHQCSVHAECRDFATGFCCRCVAGYTGNGRQCVAE
GSPQRVNGKVKGRIFVGDSQVPIVFENTDLHSYVVMNHGRSYTAISTIPETVGYSLLPLA
PIGGIIGWMFAVEQDGFKNGFSITGGEFTRQAEVTFVGHRDKLIIKQQFSGIDEHGHLTI
DTELEGRVPQIAFGSSVHIEPYTELYHYSRQVITSFSTREYTVTEPERHGTAPSHAHTYR
WRQTITFRECLHDDSRPALPSTQQLSVDSVFVLYNQEERILRYALSNSIGPVRDGSPDAL
QNPCYIGSHGCDSNAACRPGPGTQFTCECSIGFRGDGRTCYDIDECSEQPSVCGNHAICN
NHPGTFRCECVEGYQFSEAGTCVAAVGLRPVNHCETGLHDCDIPQRARCIYMGGSSYTCS
CLPGFSGDGRACQDVDECQPSRCHPDAFCYNTPGSFTCRCKSGYQGDGFHCVPGVVEKTR
CQHEREHILGTADSSRPRPPGLFVPECDEHGQYVPTQCHSSTGYCWCVDRDGREVQGTRT
RSGMRPPCLSTVAPPVHYGPPVPTTVIPLPPGTHLLFAQTGKIERLPLEGSTMTKSEAKT
LLHAPGKVIIGLAFDCVDKMVYWTDISQPSIGRASLHGGEPATIVRQDLGSPEGIALDHL
GRNIFWTDSQLDRIEVAKLDGTQRRVLFETDLVNPRGIVTDSVRGNLYWTDWNRDNPKIE
TSYMDGTNRRILVQDDLGLPNGLTFDAYSSQLCWVDAGAHRAECLKPGQSSRRKVLEGLQ
YPFAVTSFGKNLYYTDWKTNSVVAVDLAVSKETDSFHPHKQTRLYGITSALSQCPEGHNY
CSVNNGGCTHLCLATPGSRTCRCPDNTLGVDCIERK
Download sequence
Identical sequences F1MWN3
ENSBTAP00000009531 ENSBTAP00000009531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]