SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000009548 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000009548
Domain Number 1 Region: 49-227
Classification Level Classification E-value
Superfamily L domain-like 1.76e-33
Family Ngr ectodomain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000009548   Gene: ENSBTAG00000007259   Transcript: ENSBTAT00000009548
Sequence length 824
Comment pep:known_by_projection chromosome:UMD3.1:5:76173495:76175969:-1 gene:ENSBTAG00000007259 transcript:ENSBTAT00000009548 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRLGLCAAALLCVCRPGTVRADCWLIEGDKGYVWLAICSQNQPPYETIPQHINSTVHDL
RLNENKLKAVLYSSLNRFGNLTDLNLTKNEISYIEDGAFLGQSSLQVLQLGYNKLSNLTE
GMLRGMGRLQFLFVQHNLIEVVTPAAFSECPSLISIDLSSNRLSRLDGATFASLASLMVC
ELAGNPFNCECDLFGFLAWLVVFNNVTKNYDRLQCESPREFAGYPLLVPRPYHSLNAITV
LQAKCRNGSLPARPASHPTPYSTDTQREPDENSGFSPDEILSVEPPASSTTDASAGPAIK
LHQVTFTSATLVVIIPHPYSKMYVLVQYNNSYFSDVMTLKNKKEIVTLDKLRAHTEYTFC
VTSLRNSRRFNHTCLTFTTRDPVPGDLAPSTSTTTHYIMTILGCLFGMVIVLGAVYYCLR
KRRMQEEKQKSVKVKKTILEMRYGADVDAGSVVHATQKLGEPPVLPVSRMSSIPSMIGEK
LPTTSKGLEAGLDTPKVATKGNYIEVRTGTGSEGLARPEDDLPELENGQGSAAEISTIAK
EVDKVNQIINNCIDALKLDSASFLGSGSGGGDPEMAFECQSLPAASTTSSTATPVPGVLE
RPSFLSPPYKEGSHHPLQRQLSADAAVARKTCSVSSSGSIKSAKVFSLDVPDHPATPGLA
KGDSKYIEKGSPLNSPLDRLPLVPASSSGSSGGGGGAVHHLEVKPAYHCSEHRHSFPALY
YEEGTDSLSQRVSFLKPLTRTKRDSTYSQLSPRHYYSGYSSSPEYSSESTHKIWERFRPY
KKHHREEVYMAAGHALRKKVQFAKDEDLHDILDYWKGVSAQQKL
Download sequence
Identical sequences F1MWA2 L8J483
ENSBTAP00000009548 XP_005198408.1.59421 XP_005206929.1.76553 XP_005206930.1.76553 XP_005206931.1.76553 XP_005206935.1.76553 XP_005887507.1.15283 XP_015318897.1.59421 XP_015318898.1.59421 XP_015318899.1.59421 XP_019816908.1.53367 XP_019816909.1.53367 ENSBTAP00000009548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]