SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000009564 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000009564
Domain Number 1 Region: 361-703
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.03e-135
Family Transferrin 0.000000000102
Further Details:      
 
Domain Number 2 Region: 22-350
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1e-129
Family Transferrin 0.000000000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000009564   Gene: ENSBTAG00000007273   Transcript: ENSBTAT00000009564
Sequence length 704
Comment pep:known_by_projection chromosome:UMD3.1:1:136683311:136722309:-1 gene:ENSBTAG00000007273 transcript:ENSBTAT00000009564 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPAVRALLACAVLGLCLADPERTVRWCTISTHEANKCASFRENVLRILESGPFVSCVKK
TSHMDCIKAISNNEADAVTLDGGLVYEAGLKPNNLKPVVAEFHGTKDNPQTHYYAVAVVK
KDTDFKLNELRGKKSCHTGLGRSAGWNIPMGKLYKELPDPQESIQRAAANFFSASCVPCA
DQSSFPKLCQLCAGKGTDKCACSNHEPYFGYSGAFKCLMEGAGDVAFVKHSTVFDNLPNP
EDRKNYELLCGDNTRKSVDNYQECYLAMVPSHAVVARTVGGKEDVIWELLNHAQEHFGKD
KPDNFQLFQSPHGKDLLFKDSADGFLKIPSKMDFELYLGYEYVTALQNLRESKPPDSSKD
ECMVKWCAIGHQERTKCDRWSGFSGGAIECETAENTEECIAKIMKGEADAMSLDGGYLYI
AGKCGLVPVLAENYKTEDGSCKNTPEKGYLAVAVVKTSDANINWNNLKGKKSCHTAVDRT
AGWNIPMGLLYSKINNCKFDEFFSAGCAPGSPRNSSLCALCIGSEKGTGKECVPNSNERY
YGYTGAFRCLVEKGDVAFVKDQTVIQNTDGNNNEAWAKNLKKENFEVLCKDGTRKPVTDA
ENCHLARGPNHAVVSRKDKATCVEKILNKQQDDFGKSVTDCTSNFCLFQSNSKDLLFRDD
TKCLASIAKKTYDSYLGDDYVRAMTNLRQCSTSKLLEACTFHKP
Download sequence
Identical sequences G3X6N3
ENSBTAP00000009564 ENSBTAP00000009564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]