SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000009629 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000009629
Domain Number 1 Region: 291-419
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000596
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 2 Region: 579-705
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000989
Family Growth factor receptor domain 0.0086
Further Details:      
 
Domain Number 3 Region: 227-269
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000366
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 4 Region: 477-519
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000168
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 5 Region: 191-231
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000121
Family EGF-type module 0.013
Further Details:      
 
Domain Number 6 Region: 512-552
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000178
Family EGF-type module 0.014
Further Details:      
 
Domain Number 7 Region: 149-192
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000014
Family EGF-type module 0.012
Further Details:      
 
Domain Number 8 Region: 556-588
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000336
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000009629   Gene: ENSBTAG00000007319   Transcript: ENSBTAT00000009629
Sequence length 1081
Comment pep:known_by_projection chromosome:UMD3.1:21:71145150:71156637:-1 gene:ENSBTAG00000007319 transcript:ENSBTAT00000009629 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EKLLIDRVSHAGMINPEDRWKSLHFSGHVAHLELKIRVRCDENYYSPTCNKFCRPRNDFF
GHYTCDQYGNKACMDGWMGKECKEAVCKQGCNLLHGGCSVPGECRCSYGWQGRFCDECVP
YPGCVHGSCVEPWQCTCETNWGGLLCNKDLNYCGSHHPCANGGTCINAEPDQYRCACPDG
YSGKNCERAEHACASNPCANGGSCHEVPSGFECHCPSGWSGPTCALDIDECASNPCAAGG
TCVDQVDGFECVCPEQWVGATCQLDANECEGKPCLNAFSCKNLIGGYYCDCLPGWKGANC
HINVDDCRGQCQHGGTCKDLVNGYQCVCPRGFGGRHCEHQLDECASSPCHGGLCEDLVDG
FRCHCPQGFSGPLCEVDIDLCEPSPCQNGAQCYNLEGDYYCACPDDMGGKNCSEPRAPCP
GGACRVVDGCGFEAGTRVAGMGPSGVCGPHGHCISQPGGNFSCVCDSGFTGTYCHENIDD
CLGQPCRNGGTCIDEVDAFRCFCPSGWEGELCDTNPNDCLPDPCHSRGRCFDLVNDFYCM
CDDGWKGKTCHSREFQCDAYTCSNGGTCYDSGDTFRCACPPGWKGSTCTVAKNSSCLPNP
CVNGGTCVGSGDSFSCICRDGWEGRTCTHNTNDCNPLPCYNGGVCVDGVNWFRCECAPGF
AGPDCRINIDECQSSPCAYGATCVDEINGYRCSCPPGRSGLRCQEVIVFGRSCWSQGMPF
PHGSSWVEDCNSCRCLDGHRDCSKVWCGQKPCLLAGRPDALSTQCPPGQQCLEKAPGQCL
QPPCAAWGACSAEEPALPSTPCQPRSGHLDNNCARLTLRFNRDQVPQGTTVGTVCSGIRA
LPATRAAARDRLLVLLCDRPPSEASAVEVALSFSPARDVPDSTLIQSAAHAIVAAITQRG
NSSLLLAVTEVKVETVVVGRSSTGLLVTVLCGVFSVLCLACVVVCVWWMRKRRKERERSR
LPREEGPNNQWAPLNPIRNPIERPGGPGGPKDALFPCKNFTPPPRRVGEALPGPAGAGED
EEDEEPGRGEDESPEAEKFLAHKFTKDPGRSPGRPARWASGPKVDNRTLGGVSAARRAGR
E
Download sequence
Identical sequences G3X6N5
ENSBTAP00000009629 ENSBTAP00000009629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]