SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000009631 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000009631
Domain Number 1 Region: 438-567
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000148
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 2 Region: 629-671
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000281
Family EGF-type module 0.0038
Further Details:      
 
Domain Number 3 Region: 731-857
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000108
Family Growth factor receptor domain 0.0082
Further Details:      
 
Domain Number 4 Region: 663-704
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000114
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 5 Region: 374-416
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000218
Family EGF-type module 0.009
Further Details:      
 
Domain Number 6 Region: 338-378
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000023
Family EGF-type module 0.012
Further Details:      
 
Domain Number 7 Region: 297-341
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000979
Family EGF-type module 0.01
Further Details:      
 
Domain Number 8 Region: 708-742
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000016
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000009631
Domain Number - Region: 593-629
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000392
Family EGF-type module 0.066
Further Details:      
 
Domain Number - Region: 855-914
Classification Level Classification E-value
Superfamily FnI-like domain 0.00241
Family VWC domain 0.033
Further Details:      
 
Domain Number - Region: 414-445
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0359
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000009631   Gene: ENSBTAG00000012817   Transcript: ENSBTAT00000009631
Sequence length 1218
Comment pep:known chromosome:UMD3.1:13:3832286:3876681:-1 gene:ENSBTAG00000012817 transcript:ENSBTAT00000009631 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSPRTRGRPGRPLSLLLALLCALRAKVCGASGQFELEILSMENVNGELQNGNCCGGSRN
PGDRKCSRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFDLKASRGNERNRI
VLPFSFAWPRSYTLLVEAWDSSNDTVQPDSIIEKASYSGMINPGRQWQTLKQNTGVAHFE
YQIRVTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNKAICRQGCSP
KHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGTCNEPWQCLCETNWGGQLCDKDLNYC
GTHQPCLNGGTCSNTGPDKYQCSCPEGYSGPNCEIAEHACLSDPCHNRGSCKETSLGFEC
ECSPGWTGPTCSTNIDDCSPNNCAHGGTCQDLVNGFQCVCPPQWTGKTCQLDANECEAKP
CVNARSCKNLIASYYCNCLPGWMGQNCDININDCVGQCQNDASCRDLVNGYRCICPPGYA
GDHCETDIDECASNPCLNGGHCQNEINRFQCLCPTGFSGNLCQLDIDYCEPNPCQNGAQC
YNRASDYFCKCPEDYEGKNCSHLKDHCRTTPCEVIDSCTVAMASNDTPEGVRYISSNVCG
PHGKCKSQSGGKFTCDCNKGFTGTYCHENINDCESNPCRNGGTCIDGVNSYACICSGGWE
GAHCETNINDCSQNPCHNGGSCRDLVNDFYCDCKNGWKGKTCHSRDSQCDEATCNNGGTC
YDEGDAFKCMCPGGWEGTTCNIARNSSCLPSPCHNGGTCVVNGESFTCVCKEGWEGPICT
QNTNDCSPHPCYNSGTCVDGENWYRCECAPGFAGPDCRININECQSSPCAFGATCVDEIN
GYRCICPPGHSGAKCQEVSGRSCVTMGSVIPDGAKWDADCNACQCLDGRVACSKVWCGPR
PCSLHRGHSECPSGQSCVPILDTQCFVRPCTGVGECRSSSLQPVKTKCASDPYYQDNCAN
ITFTFNKEMMSPGLTTEHICSELRNLNILKNVSAEYSIYIACEPSPSANNEIHVAISAED
IRDDGNPIKEITDKIINLVSKRDGNSSLIAAVAEVRVQRRPLKSRTDFLVPLLSSVLTVA
WVCCLVTAFYWCVRKRRKPGSHARAASEDNTTNNVREQLNQIKNPIEKHGANTVPVKDYE
SKNSKMSKIRTHNSEVEEDDMDKHQQKARFAKQATYTLVDREEKPAHGTPAKHPNWTNKQ
DNRDLESAQSLNRMEYIV
Download sequence
Identical sequences E1BDN7
NP_001178107.1.59421 NP_001178107.1.76553 XP_019828436.1.53367 ENSBTAP00000009631 ENSBTAP00000009631 9913.ENSBTAP00000009631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]