SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000009633 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000009633
Domain Number 1 Region: 47-318
Classification Level Classification E-value
Superfamily L domain-like 8.25e-57
Family Ngr ectodomain-like 0.001
Further Details:      
 
Domain Number 2 Region: 352-446
Classification Level Classification E-value
Superfamily Immunoglobulin 4.92e-21
Family V set domains (antibody variable domain-like) 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000009633   Gene: ENSBTAG00000007324   Transcript: ENSBTAT00000009633
Sequence length 640
Comment pep:known_by_projection chromosome:UMD3.1:15:71243845:71245767:-1 gene:ENSBTAG00000007324 transcript:ENSBTAT00000009633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLNKMTLHPQQIMIGPRFNRALFDPLLVVLLALQLLVVAGLVRAQTCPSVCSCSNQFSKV
ICVRKNLRDVPDGISTNTRLLNLHENQIQIIKVNSFKHLRHLEILQLSRNHIRTIEIGAF
NGLANLNTLELFDNRLTTIPNGAFVYLSKLKELWLRNNPIESIPSYAFNRIPSLRRLDLG
ELKRLSYISEGAFEGLSNLRYLNLAMCNLREIPNLTPLIKLDELDLSGNHLSAIRPGSFQ
GLMHLQKLWMIQSQIQVIERNAFDNLQSLVEINLAHNNLTLLPHDLFTPLHHLERIHLHH
NPWNCNCDILWLSWWIKDMAPSNTACCARCNTPPNLKGRYIGELDQNYFTCYAPVIVEPP
ADLNVTEGMAAELKCRASTSLTSVSWITPNGTVMTHGAYKVRIAVLSDGTLNFTNVTVQD
TGMYTCMVSNSVGNTTASATLNVTAATTTPFSYFSTVTVETMEPSQDEARTTDNNVGPTP
VIDWETTNVTTSLTPQSTRSTEKTFTIPVTDINSGIPGIDEVMKTTKIIIGCFVAITLMA
AVMLVIFYKMRKQHHRQNHHAPTRTVEIINVDDEITGDTPMESHLPMPAIEHEHLNHYNS
YKSPFNHTTTVNTINSIHSSVHEPLLIRMNSKDNVQETQI
Download sequence
Identical sequences F1MXH5 W5PLP9
ENSBTAP00000009633 ENSOARP00000011372 XP_002693573.1.76553 XP_003587053.1.76553 XP_004016464.1.66739 XP_005194748.1.59421 XP_005980951.1.78601 XP_005980952.1.78601 XP_005980953.1.78601 XP_010854515.1.44457 XP_010854520.1.44457 XP_010854527.1.44457 XP_010854535.1.44457 XP_012015525.1.54773 XP_015322093.1.59421 XP_015330420.1.76553 XP_019831396.1.53367 XP_883783.1.59421 ENSBTAP00000009633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]