SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000009824 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000009824
Domain Number 1 Region: 283-464
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.94e-64
Family SPRY domain 0.00001
Further Details:      
 
Domain Number 2 Region: 10-84
Classification Level Classification E-value
Superfamily RING/U-box 4.2e-19
Family RING finger domain, C3HC4 0.015
Further Details:      
 
Domain Number 3 Region: 91-152
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000336
Family B-box zinc-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000009824   Gene: ENSBTAG00000007470   Transcript: ENSBTAT00000009824
Sequence length 487
Comment pep:known_by_projection chromosome:UMD3.1:7:42623076:42637851:1 gene:ENSBTAG00000007470 transcript:ENSBTAT00000009824 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGSPGERLCEEARCPVCLDFLQNPVSVDCGHSFCLRCISEFCEKSDSAQGGIYACPQC
RGPFRLESFRPNRQLASLVDSVRQLGLGAEPSGARLCVRHGEELTRFCEEDQEVLCWVCD
TTPEHRSHHTISLQEAARCYQIKLQVAQELVRKELEEASTQEANVGKKTVIWKEKVEMQR
QRFRWEFEKYRGFLALEEQLQLRRLEEEERATLQKLRESKNRLVQQSRALKELAEELEER
CQRPALGLLEGVGGALSRSKNVTRLEPESIVMELKTMCRIPGMREMLRKFQVDIKLDPAT
AHPSLLLTADLRSVQDGELWRDVPNNPERFDTWPCILGLQNFSSGRHYWEVMVGERAEWG
LGVCQDTVSRKGEITPSPENGVWAMWLLKGSEYMVLASPSVPLLHLERPRCIGIFLDYEA
GEISFYNITNGSFIYTFNHLFSGFLRPYFFICDTTPLILPPMTEVELENWTSRGHSDSAS
DIRDDSS
Download sequence
Identical sequences F1MVU7
ENSBTAP00000009824 ENSBTAP00000009824 XP_002689127.1.76553 XP_019820361.1.53367 XP_603937.2.59421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]