SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000009893 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000009893
Domain Number 1 Region: 324-500
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.73e-63
Family SPRY domain 0.000014
Further Details:      
 
Domain Number 2 Region: 35-107
Classification Level Classification E-value
Superfamily RING/U-box 3.53e-17
Family RING finger domain, C3HC4 0.042
Further Details:      
 
Domain Number 3 Region: 113-142
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000412
Family B-box zinc-binding domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000009893   Gene: ENSBTAG00000007518   Transcript: ENSBTAT00000009893
Sequence length 502
Comment pep:known_by_projection chromosome:UMD3.1:10:104182289:104218056:1 gene:ENSBTAG00000007518 transcript:ENSBTAT00000009893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVSSNLSSKTDTDSDSYAEVNDVITQISSKVQIQDITTELHCPLCNDWFRDALMLSCGH
NFCQSCIQNFWKQQANETFCPECKMLCQYSNCTFNLVLEKLVEKIKKLPLLKGHPRCPEH
GENLKLFSKPDGRLICFQCKDARLSVGQSKEFLQISDAVHFFTEELTIHQGQLEATLKEL
QSLKNMQKDAIAAHKENKLHLQQHISLEFLKLHQFLHSKEKDLLSELREEGKALNEEMEL
NLSHIQEQCLLAKEMLVSIQARMEQQNPFDFLKDITPLLDSLEQGMRMLTPKELVSRKLS
PGVFKGPIQYTIWRDMQSTLSPGLSPLTLDPKTAHPNLVLSKNRTSVWHGDIKQLMPDDP
ERFDSSVAVLGSKGFTSGKWYWEVEVAKKTKWTVGVVRESILRKGSCPLTPEQGFWLLRL
RNQTDLKALDFPSCSLKLTNNLNKVGIYLDYEGGQVSFYNAKTMTHIYTFSSVFMEKLYP
YFCPCLNDGGENKEPLHILHPQ
Download sequence
Identical sequences E1BID7
ENSBTAP00000009893 9913.ENSBTAP00000009893 XP_019823549.1.53367 ENSBTAP00000009893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]