SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000009909 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000009909
Domain Number 1 Region: 308-474
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-46
Family SPRY domain 0.00015
Further Details:      
 
Domain Number 2 Region: 8-85
Classification Level Classification E-value
Superfamily RING/U-box 2.87e-20
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Domain Number 3 Region: 95-154
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000733
Family B-box zinc-binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000009909   Gene: ENSBTAG00000007530   Transcript: ENSBTAT00000009909
Sequence length 489
Comment pep:known chromosome:UMD3.1:23:28613833:28622421:1 gene:ENSBTAG00000007530 transcript:ENSBTAT00000009909 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASAASVTSLADEVNCPVCQGTLREPVTIDCGHNFCRVCLTRYLEITSPDPEEPPTCPLC
KEPFRPGNFRPNWQLANVVENIERLKLVSQMDLDEEDVCPEHGEKVYFFCEDDEMQLCVV
CREAWEHRAHTVRFLEDAAGPYREQIQKCLECLRKEREEIQEIQSRENRRIQVLLTQVAT
KKQKVISEFAHLSQFLEEQQNILLDQLEKLDEDILKHRDEFDVLVTGEIGRFNTLIEELE
EKKERPARELLTDIRSTLIRCETRRCRKPVAISPELGQRIRDFPQQAFPLQREMKMFLEK
LSFELDYEPAHISLDPRTSHPKLLLSEDYQQARFSYKWQKSPDNPQRFDRATCVLAHGGF
TGGRHTWVVSVDLAHGGSCTLGVVSKDIRRKGELRMRPEEGVWAVRLAWGFVSALNSFPT
RLTLEEQPQQVRVSIDYEVGWVTFANAVTQEPIYTFTASFTQKVFPFFGLWGRGSKFSLS
SQEGAATLS
Download sequence
Identical sequences F1MTR5
ENSBTAP00000009909 ENSBTAP00000009909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]