SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000009998 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000009998
Domain Number 1 Region: 29-147
Classification Level Classification E-value
Superfamily FKBP-like 3.14e-42
Family FKBP immunophilin/proline isomerase 0.000000786
Further Details:      
 
Domain Number 2 Region: 258-415
Classification Level Classification E-value
Superfamily TPR-like 1.24e-33
Family Tetratricopeptide repeat (TPR) 0.000000136
Further Details:      
 
Domain Number 3 Region: 142-257
Classification Level Classification E-value
Superfamily FKBP-like 1.32e-28
Family FKBP immunophilin/proline isomerase 0.000000905
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000009998   Gene: ENSBTAG00000007605   Transcript: ENSBTAT00000009998
Sequence length 459
Comment pep:known chromosome:UMD3.1:5:107445596:107453517:-1 gene:ENSBTAG00000007605 transcript:ENSBTAT00000009998 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAEETKAAESGAQSAPLRLEGVDISPKQDEGVLKVIKREGTGMETPMIGDRVFVHYTGW
LLDGTKFDSSLDRKDRFSFDLGKGEVIKAWDIAVATMKVGEVCHITCKPEYAYGLAGSPP
KIPPNATLVFEVELFEFKGEDLTEEEDGGIIRRIRTRGEGYAKPNEGALVEVALEGYFKD
QVFDRRELRFEVGEGESMDLPCGLEKAIQRMEKGEHSIVYLKPRYAFGSAGKEKFQIPPN
AELKYEIHLKSFEKAKESWEMSSEEKLEQSTIVKERGTVYFKEGKYKQAVLQYKKIVSWL
EYESSFSDEDAEKAQALRLASHLNLAMCHLKLQAFSAAIENCNKALELDSNNEKGLFRRG
EAHLAVNDFDLARADFQKVLQLYPSNKAAKAQLVVCQQRIRKQLEKEKKLYANMFERLAE
EETKAKATVAAGDQPADAEMRDEPKNDVAGGQPQVEAEA
Download sequence
Identical sequences F1MU79
ENSBTAP00000009998 ENSBTAP00000009998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]