SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000010056 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000010056
Domain Number 1 Region: 211-284
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-25
Family SPRY domain 0.00072
Further Details:      
 
Domain Number 2 Region: 14-74
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.53e-17
Family B-box zinc-binding domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000010056   Gene: ENSBTAG00000007643   Transcript: ENSBTAT00000010056
Sequence length 415
Comment pep:known_by_projection chromosome:UMD3.1:23:28257737:28271232:-1 gene:ENSBTAG00000007643 transcript:ENSBTAT00000010056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EIAKQLQAVKRKIRDESLCPQHHEALSLFCYEDQEAVCLICAISHTHRAHTVVPLDDATQ
EYKEKLQKCLEPLEQKLQEISRCKSAEEKKPGELKRLVESRRQQILKEFEELHRRLDEEQ
QVLLSRLEEEEQDILQRLRENAAHLGDKRRDLAHLAAEVEGKCLQSGFEMLKDVKSTLEK
CEKVKTMEVTSVSIELEKNFSNFPRQYFALRKILKQLIADVTLDPETAHPNLVLSEDRKS
VKFVETRLRDLPDTPRRFTFYPCVLATEGFTSGRHYWEVEAAHCVLAQDPENQALARFYC
HTERTIAKRLVLRRDPSVKRTLCRGCSSLLIPGLTCTQRQRRCKGQRWTVQTCLTCQRSQ
RFLNDPRHVLWGDRPEAQLGNQADPKPPQPLPNTAHPIPAQLPKEKVQPQSSSHP
Download sequence
Identical sequences E1B7D3
ENSBTAP00000010056 ENSBTAP00000010056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]