SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000010138 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000010138
Domain Number 1 Region: 100-395
Classification Level Classification E-value
Superfamily L domain-like 5.95e-61
Family Internalin LRR domain 0.024
Further Details:      
 
Domain Number 2 Region: 355-558
Classification Level Classification E-value
Superfamily L domain-like 2.72e-42
Family Internalin LRR domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000010138   Gene: ENSBTAG00000007709   Transcript: ENSBTAT00000010138
Sequence length 582
Comment pep:known chromosome:UMD3.1:26:31762792:31849699:1 gene:ENSBTAG00000007709 transcript:ENSBTAT00000010138 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSLGKEKDSKEKDPKAPSAKEREKEAKASGGFGKESKEKEPKTKGKDAKDGKKDSSAA
QPGVAFSVDNTIKRPNPAPGTRKKSSNAEVIKELNKCREENSMRLDLSKRSIHILPSSIK
ELTQLTELYLYSNKLQSLPAEVGCLVNLMTLALSENSLTSLPDSLDNLKKLRMLDLRHNK
LREIPSVVYRLDSLTTLYLRFNRITTVEKDIKNLSKLSMLSIRENKIKQLPAEIGELCNL
ITLDVAHNQLEHLPKEIGNCTQITNLDLQHNELLDLPDTIGNLSSLSRLGLRYNRLSAIP
RSLAKCSALEELNLENNNISTLPESLLSSLVKLNSLTLARNCFQLYPVGGPSQFSTIYSL
NMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSLPLDFGTWTSMVELNLATNQLTKIPED
VSGLVSLEVLILSNNLLKKLPHGLGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTN
NQLTTLPRGIGHLTNLTHLGLGENLLTHLPEEIGTLENLEELYLNDNPNLHSLPFELALC
SKLSIMSIENCPLSHLPPQIVAGGPSFIIQFLKMQGPYRAMV
Download sequence
Identical sequences A6QLV3 L8ILV1 W5PLK6
ENSOARP00000011329 ENSTTRP00000006602 NP_001095413.1.59421 NP_001095413.1.76553 XP_004020244.1.66739 XP_004265894.1.21590 XP_005225784.1.76553 XP_005698523.1.57651 XP_005698524.1.57651 XP_005894817.1.15283 XP_005983251.1.78601 XP_006043988.1.26621 XP_006043989.1.26621 XP_007173138.1.59432 XP_007469693.1.90284 XP_010818331.1.76553 XP_010857663.1.44457 XP_010857664.1.44457 XP_010857665.1.44457 XP_010857666.1.44457 XP_011958305.1.66739 XP_011958306.1.66739 XP_011958307.1.66739 XP_011983786.1.54773 XP_011983787.1.54773 XP_011983788.1.54773 XP_011983790.1.54773 XP_011983791.1.54773 XP_014958900.1.66739 XP_017896764.1.57651 XP_017896765.1.57651 XP_019795537.1.83887 XP_019795538.1.83887 XP_019795540.1.83887 XP_019795541.1.83887 XP_019795542.1.83887 XP_020761108.1.74333 XP_020761109.1.74333 XP_020761110.1.74333 XP_020761112.1.74333 XP_020761113.1.74333 ENSBTAP00000010138 ENSTTRP00000006602 ENSBTAP00000010138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]