SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000010187 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000010187
Domain Number 1 Region: 291-387
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000155
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0051
Further Details:      
 
Domain Number 2 Region: 121-189
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000196
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.069
Further Details:      
 
Domain Number 3 Region: 37-78
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000733
Family HLH, helix-loop-helix DNA-binding domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000010187   Gene: ENSBTAG00000007746   Transcript: ENSBTAT00000010187
Sequence length 844
Comment pep:known chromosome:UMD3.1:4:25785333:25834977:1 gene:ENSBTAG00000007746 transcript:ENSBTAT00000010187 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSSSANITYASRKRRKPVQKTVKPVPAEGIKSNPSKRHRDRLNTELDRLASLLPFPPDV
INKLDKLSVLRLSVSYLRAKSFFDVALKSSPADRNGVQDNCRTKFREGLNLQEGEFLLQA
LNGFVLVVTTDALVFYASSTIQDYLGFQQSDVIHQSVYELIHTEDRAEFQRQLHWALNPQ
QCPDSGQRIDEANGLSQPAVYYNPDQIPPENSSFMERCFVCRLRCLLDNSSGFLAMNFQG
RLKYLHGQNKKGKDGSILPPQLALFAIATPLQPPSILEIRTKNFIFRTKHKLDFTPTGCD
AKGKLVLGYTEAELSMRGSGYQFVHAADMLYCAEYHIRMIKTGESGMIVFRLLTKDNRWA
WVQSNARLVYKNGRPDYIIATQRPLTDEEGMEHLNKRNMKLPFMFTTGDAILYEISNPFP
SVMDPLPIKTKNGAGGKESTTTSALSKDSLNPSSLLNAMMQQDEAIYLYPASTSTPFERN
FFSDSLNECSNWQNNVVPMGSDSILKHEQISQSQDMNPTLSGDHTGLFADNRNSDLYNIM
KHLGIDFEDIEHMQQNEEFFRTDFSGEDDFRDIDLTDEILTYVEDSLNKPAFGCSGYPQQ
PSMALNPSCMVQEQLQLDQQQLQPHQRHTTVEQQQQLCQKMKHMQVNSMFANWNANQSVP
LNCPQQDLQQYVFADLPGTSQEFPYKPELDPMPYPQNLIPYSQPGLPPQPQGAQLDFPMG
DFEPAPYPTTASNLEDFVSCLQVPENQQHGLNPQSAMVAPQTCYAGAVSMYQCQPDPQHS
QLAQMQYNPTTPGSQAVVNKFQNGAILNETYPAELNSMRNTEPATRLHPSEARPYPDLTS
SGFL
Download sequence
Identical sequences F1ML85
9913.ENSBTAP00000010187 ENSBTAP00000010187 ENSBTAP00000010187 NP_001192955.1.59421 NP_001192955.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]