SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000010264 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000010264
Domain Number 1 Region: 129-200
Classification Level Classification E-value
Superfamily RILP dimerisation region 1.26e-18
Family RILP dimerisation region 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000010264   Gene: ENSBTAG00000007804   Transcript: ENSBTAT00000010264
Sequence length 206
Comment pep:known chromosome:UMD3.1:17:54425952:54452508:1 gene:ENSBTAG00000007804 transcript:ENSBTAT00000010264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEPPLREEEEEEEEDEAGPEGALGKSPLQLTAEDVYDISYVMGRELMALGSDPRVTQLQ
FKIVRVLEMLETLVNEGNLTVEELRMERDNLRKEVEGLRREGSAAGPEVNLGPDKMVVDL
TDPNRPRFTLQELRDVLQERNKLKSQLLVVQEELQCYKSGLIPPREGPGGRREKEALFPR
GSNANSNKEEKTIIRKLFSFRSGKQT
Download sequence
Identical sequences A4IFK7
ENSBTAP00000010264 9913.ENSBTAP00000010264 NP_001077187.1.59421 NP_001077187.1.76553 XP_010839597.1.44457 XP_019833539.1.53367 ENSBTAP00000010264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]