SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000010315 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000010315
Domain Number 1 Region: 445-584,701-861
Classification Level Classification E-value
Superfamily Substrate-binding domain of HMG-CoA reductase 2.88e-115
Family Substrate-binding domain of HMG-CoA reductase 0.000000000082
Further Details:      
 
Domain Number 2 Region: 587-703
Classification Level Classification E-value
Superfamily NAD-binding domain of HMG-CoA reductase 4.05e-45
Family NAD-binding domain of HMG-CoA reductase 0.000000567
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000010315
Domain Number - Region: 45-219
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 0.000144
Family Multidrug efflux transporter AcrB transmembrane domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000010315   Gene: ENSBTAG00000007840   Transcript: ENSBTAT00000010315
Sequence length 888
Comment pep:known chromosome:UMD3.1:10:6692478:6713106:1 gene:ENSBTAG00000007840 transcript:ENSBTAT00000010315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSRLFRMHGLFVASHPWEVIVGTVTLTICMMSMNMFTGNNKICGWNYECPKLEEDVLSS
DIIILTITRCIAILYIYFQFQNLRQLGSKYILGIAGLFTIFSSFVFSTVVIHFLDKELTG
LNEALPFFLLLVDLSRASALAKFALSSNSQDEVRENIARGMAILGPTFTLDALVECLVIG
VGTMSGVRQLEIMCCFGCMSVLANYFVFMTFFPACVSLVLELSRESREGRPIWQLSHFAR
VLEEEENKPNPVTQRVKMIMSLGLVLVHAHSRWIADPSPQNSTADNSKVSLGLDENVSKR
IEPSVSLWQFYLSKMISMDIEQVITLSLALLLAVKYIFFEQAETESTLSLKNPITSPVVT
QKKITDDCCRRDPVLVRNDQKFHAMEEETRKNRERKVEVIKPLLAENDTSHRATFVVGNS
SLLGTSLELETQEPEMELPVEPRPNEECLQILENAEKGAKFLSDAEIIQLVNAKHIPAYK
LETLMETHERGVSIRRQLLSKKLPEPSSLQYLPYRDYNYSLVMGACCENVIGYMPIPVGV
AGPLCLDGKEFQVPMATTEGCLVASTNRGCRAIGLGGGASSRVLADGMTRGPVVRFPRAC
DSAEVKAWLETPEGFTVIKEAFDSTSRFARLQKLHMSVAGRNLYIRFQSRSGDAMGMNMI
SKGTEKALSKLQEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKSVVCEAVIPAKVVREV
LKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSSNCITL
MEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACRDNPGENARQLAR
IVCGTVMAGELSLMAALAAGHLVRSHMIHNRSKINLQDLQGTCTKKAA
Download sequence
Identical sequences A7Z064
ENSBTAP00000010315 ENSBTAP00000010315 9913.ENSBTAP00000010315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]