SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000010376 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000010376
Domain Number 1 Region: 78-186,308-424
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.39e-55
Family Phosphate binding protein-like 0.00000000849
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000010376
Domain Number - Region: 249-281
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0691
Family Voltage-gated potassium channels 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000010376   Gene: ENSBTAG00000007887   Transcript: ENSBTAT00000010376
Sequence length 1091
Comment pep:known chromosome:UMD3.1:25:8554540:8655588:-1 gene:ENSBTAG00000007887 transcript:ENSBTAT00000010376 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVGKWENQTLSLRHAVWPRYKSFSDCEPDDNHLSIVTLEEAPFVIVEDIDPLTETCVRNT
VPCRKFVKINNSTNEGMNVKKCCKGFCIDILKKLSRTVKFTYDLYLVTNGKHGKKVNNVW
NGMIGEVVYHRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRSNGTVSPSAFLEPF
SASVWVMMFVMLLIVSAIAVFVFEYFSPVGYNRNLAKGKAPHGPSFTIGKAIWLLWGLVF
NNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEFVDQVTGLSDKKFQRP
HDYSPPFRFGTVPNGSTERNIRNNYPYMHQYMTKFNQKGVEDALVSLKTGKLDAFIYDAA
VLNYKAGRDEGCKLVTIGSGYIFATTGYGIALQKGSPWKRQIDLALLQFVGDGEMEELET
LWLTGICHNEKNEVMSSQLDIDNMAGVFYMLAAAMALSLITFIWEHLFYWKLRFCFTGVC
SDRPGLLFSISRGIYSCIHGVHIEEKKKSPDFNLTGSQSNMLKLLRSAKNISNLSNMNSS
RMDSPKRAADFIQRGSLIVDMVSDKGNLVYSDNRSFQGKDSIFGDNMNELQTFVANRHKD
NLNNYVFQGQHPLTLNESNPNTVEVAVSTESKGNSRPRQLWKKSMESIRQDSLTQNPISQ
RDEGPVENRTHSLKSPRYLPEEVAHSDISETSSRATCHREPDNNKNHKAKDNFKRSMASK
YPKDCSEAERSYLKTKASSPRDKIYTIDGEKEPSFHLDPPSFAESMALPENVDFPDTYQE
RSESFRKGDSTLPLNRNALHEEDVLPNNEPYKLYSKHFSLKDKSSPHSEGSDRYRQNSTH
CRSCLSNLPTYAGHFTVRSPFKCDACLRMGNLYDIDEDQMLQETGNPAAQEEVYQQDWAP
NSALQLQKNKLRISRQHSYDNILDKPREVDPSRPSRSISLKDRERLLEGNLYGSLFSVPS
SKLAGNKGSLFPQGLEVGKRSKSLLPDHTSENPFLHSYGDDQRLVIGRCPSDPYKHSLPS
QAANDGYLRSSLRSTASYCSRDSRGHSDVYISEHVMPYAANKNNMYSAPRVLNSCSNRRV
YKKMPSIESDV
Download sequence
Identical sequences F1MLZ9
ENSBTAP00000010376 9913.ENSBTAP00000010376 ENSBTAP00000010376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]